KEGG   Anolis carolinensis (green anole): 100564462Help
Entry
100564462         CDS       T01608                                 

Gene name
usp47
Definition
(RefSeq) ubiquitin specific peptidase 47
  KO
K11857  ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100564462 (usp47)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100564462 (usp47)
Ubiquitin system [BR:acs04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100564462 (usp47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Ubiquitin_2
Motif
Other DBs
NCBI-GeneID: 100564462
NCBI-ProteinID: XP_008114142
Ensembl: ENSACAG00000004976
UniProt: H9G9T9
Position
Un
AA seq 1376 aa AA seqDB search
MVPSEENQLVPKEDMLWRCRQSIFDEMKKKFSQNESAADEPRVLCIIQDTTNSKTVNERI
TLNLPASTPVKRLFEDVATKVGYVNGTFDLIWGNGVNVANTTPLDQSSDKSVVNAGFESG
KKNFLHLTDKDGEQPQIALEESGGADGHNPDRFIGPLPREGSVGCSSDYASQNYSYSSIL
SKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLF
VLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQL
YQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPN
QYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMGSF
IDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLESNSTVERISKVAN
EKNSLLYELFSVMVHSGSAAGGHYYACIKSFSDDQWYSFNDQHVSKITHEDIKKTYGGTS
GSRGYYSSAFASSTNAYMLIYRLKDTMRNAKFLEVNEYPEHIKKLVEKEKELEEQEKRQR
EIERNTCKIKLFCMHPVKQIMMENKLEVHKDKTLKEAVEIAYKILNLEEAVPLNCCRLVK
YDEFHDYLERSYEGEEETPMGILLGGVKSTYMFDLLLETRQPDQAFQCYKPGEVMVKVHV
VDLKQETVAPPISVRAYLNQTVTEFKHLISKAIHLPAETMRVVLERCYNDLRLLSVANKT
LKAEGFFRSNKVFIESSESQDRQLAFPDSLLWKLLDRHANTIRLYVSLPEQSPGTQIRRT
VFQKASGDSGNLDEICKRLKGSLGNMKSVEAILEESTEKLKTLSLQQQQQEGDNGDSSKS
TEASDFENIESPSNDIDSSTSTENRELENQIQVSDPDNFQSEERSDSDLNNDRSTSSVDS
DILSSSHSSDTLCNVDNAPMPLANGLDSHSITSSRRSKANEGKKETWDTAEEDSGTDSEY
DESGKSRGETQYMYFKAEPYIAEEGAGEGQKWLLIHVDKRITLSAFKQHLEPFVGVSSSQ
FKVFRVCASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNDPEPCK
FLLDSVFAKGMTVRQSKEELLPQLREQCGLDLTIDRFRLRKKTWKNPGTVFLDYHVYEED
INISSNWEVFLEILDGAEKMKSMSQLAVLSRRWRPSEMKLDLFQEVVLESSSVDELKEKL
SEISGISLENIEFAKGRGTFPCEISVLEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRD
KTEEVVELTEEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagtgaggagaaccagctggtccccaaagaggatatgctttggagatgcaga
caaagtatatttgatgaaatgaagaagaaattttcacagaatgaaagtgctgctgatgaa
cctagagtgctttgtataatacaagatactactaattctaagacagtgaatgagcgcatc
acattgaacttaccagcttccactccagtaaaaagactgtttgaggatgtggccaccaaa
gtgggctatgttaatggaacatttgatttaatttggggaaatggcgtcaatgttgcaaat
acgacaccattggatcaatccagtgataaatctgtggttaatgctggttttgagtctggg
aagaagaattttttgcatctgacagataaagatggagaacaacctcaaatagccttggag
gagtctggtggagcagatggtcataatccagataggtttatcggtcctcttccacgagaa
ggttcagttggttgttccagtgattatgccagtcagaactactcttattcgtcaattttg
agtaaatcagaaacaggatacgtaggtctagtaaatcaagcaatgacctgctatttgaac
agccttctgcaaacccttttcatgactcccgaatttagaaatgcattatacaaatgggaa
tttgaggaatccgaagaagatccagtgacaagtatcccttatcagcttcaaaggctgttt
gttttactacagaccagcaaaaaaagagcaattgaaacaacagatgtaacacggagcttt
ggatgggatagtagtgaggcatggcagcagcacgatgtacaagaactctgtagagtcatg
tttgatgctttggaacaaaaatggaaacaaacagagcaggctgatctcataaatcagctc
tatcaaggcaagctgaaggattatgtaaggtgcttggaatgcggctatgagagttggaga
attgatacatacctggatattcctttggtcattcgaccttatggctccagtcaggctttt
gcaagtgtggaggaagcactacatgctttcatacaacctgaaatccttgatggccctaat
cagtatttctgtgaacggtgtaagaagaaatgtgatgccagaaaggggttacgattctta
cactttccatatctactaaccttacagctaaagagatttgactttgattataccaccatg
cataggataaaacttaatgatcgcatgacatttcccgaagagctagacatgggctcgttc
attgatattgaagatgagaagtctcctcaaacagagagttgcactgacagtggagcagag
aatgaaggcagttgtcacagcgatcagatgagcaatgatttttctaatgatgatggagtt
gatgaagggatatgtcttgaaagcaatagtactgttgaaagaatttctaaagttgccaat
gaaaagaattcattattatatgaattgttttctgttatggttcattcgggaagtgcagct
ggtggccattattatgcatgcattaaatcgtttagtgatgaccagtggtatagtttcaat
gatcagcatgttagcaagataacacatgaagacatcaagaaaacatatggtgggacatct
ggaagcagaggatactattccagtgcttttgcaagctctacgaatgcatatatgctgatt
tatagactgaaggatacaatgagaaatgcaaagttcctagaagtgaatgaatatccagag
catattaaaaaactggtagaaaaagaaaaggagttagaagaacaagaaaagaggcaacgg
gaaatagagcgtaatacctgcaagataaaactgttttgtatgcatcctgtgaagcaaata
atgatggagaataaactagaagttcacaaggacaagacactgaaagaagctgtggagata
gcttataagatattaaatttagaagaggcagttcctctgaactgttgccgtctggttaaa
tatgatgagttccacgattatttggaacgatcatatgaaggagaagaggagacaccgatg
ggaatcttgcttggaggtgttaagtcaacctatatgttcgatcttcttctggagacaagg
cagccagatcaggctttccagtgttacaagcctggtgaagtaatggtaaaagtccatgtt
gttgatctgaagcaagaaactgtggctcctcctattagtgtccgtgcttatttgaaccag
acagtcacagaattcaagcatctaatttcaaaggctatacatttgcctgctgaaacaatg
cgagtagtgttggaacgttgctacaatgacttgcgtcttctcagtgtggccaacaaaact
ctgaaagctgaaggcttttttaggagcaataaagtatttattgaaagttcagagtcccag
gatcgacagctggcatttccagattcactgttgtggaaactcctggatcgtcatgcaaat
acaattagactgtatgtttcattaccagagcagtctcctggaacacaaatcagaaggaca
gtttttcagaaagccagcggagattctggcaatttagatgaaatttgtaaaagacttaaa
ggatctttaggtaatatgaaatcagtagaagctattctagaagagagcaccgaaaaactg
aaaactttgtctctgcagcagcaacagcaagaaggggataatggggacagcagcaagagt
acagaggcaagtgactttgagaacatcgaatcaccttcaaatgacatagattcatcaacg
tcaacagaaaatcgagaacttgaaaaccaaattcaagtttctgatccagataatttccag
tcagaagagagatcagattctgatctgaacaacgacagaagtaccagttcagtggacagt
gatatcctcagttccagccacagcagtgacacattgtgcaatgtagacaatgccccgatg
cccttggcgaatggacttgactcacacagtatcacaagcagcaggagatccaaagccaat
gaaggaaaaaaggagacatgggatacagctgaagaggattctggaactgacagtgaatat
gatgaaagtggaaagagcagaggagaaacacagtatatgtacttcaaggcagaaccctac
attgcagaagaaggtgcaggagaaggacaaaaatggttgttgattcatgttgataaaaga
attacactttctgccttcaaacaacacctggagccatttgttggagtttcttcctcccag
tttaaggtgtttcgagtttgtgccagcaatcaagaatttgaaagcgttcgactaaatgaa
acactttcttccttttcagatgacaacaagataacaattagacttgggagagcactgaag
aagggagaatacagagtcaaagtttatcagctgttggtaaatgatcctgagccctgcaag
tttcttttagattctgtttttgctaaaggaatgactgtacggcagtcaaaagaagaatta
cttcctcagctcagggaacagtgtgggctagatttgactattgacagattccggttacga
aagaaaacgtggaaaaatccaggaactgtgtttctggattatcatgtttatgaagaagat
attaatatttcaagtaactgggaggttttccttgaaatacttgatggggcagaaaagatg
aaatctatgtcacagcttgctgttctgtcaagaagatggaggccatcagagatgaagttg
gatctttttcaggaagtagttttggagagtagtagtgttgatgaattgaaagaaaagctg
agtgaaattagtggaatctctttagaaaacattgagttcgcaaagggcagaggaacattt
ccttgtgagatctctgttctagagatccatcaggatttggactggaatcctaaggtttct
acactgaatgtatggcctctctatatttgtgatgatggagcagtgatattttatagggat
aaaactgaggaagtggtggaactgacagaagaacaaagaaatgagttaatgaaaaaagaa
agcagccgacttcagaaaactggacaccgtgttacctactcccctcgtaaagaaaaagca
ctaaaaatatatctggacggagcgccaaataaagatttgactcaagactga

DBGET integrated database retrieval system