KEGG   Anolis carolinensis (green anole): 100565356
Entry
100565356         CDS       T01608                                 

Gene name
erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acs01002]
    100565356 (erap1)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100565356 (erap1)
Peptidases and inhibitors [BR:acs01002]
 Metallo peptidases
  Family M1
   100565356 (erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N FlaC_arch
Other DBs
NCBI-GeneID: 100565356
NCBI-ProteinID: XP_008101275
Ensembl: ENSACAG00000012299
UniProt: G1KMG9
Position
2
AA seq 929 aa
MMIFLLCIFNIVSVFGSDQHSGKPYSVTGNGSSPFPWNKMRLPKHVLPVHYDLLIHPNLT
TLTFTGLAKIEINITQETSSIILHSKYLQITKAVIEEAKENIRTDKPVTVLEYPPFEQIA
LIVTKPLHLGNYIVSIEYSANLSDSFHGFYKSTYRTPEGEVRVLASTQFEPTAARKAFPC
FDEPAFKAKFSVKIRREPRHFALSNMPLVKSVNLKEWLIEDHFQTSIKMSTYLVAFIVSD
FKSVSKITTRGVKVSVYTVPHKINQADYALDAAVKLLEFFEEYFSIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETALLYDPEKSIASSKLGITLTIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFLSVRVTHPELKVEDYFLNKYFEAMEVDALNSSHPISTPVEEPSQILEMF
DDVSYDKGACILNMLQDYLSPEVFKAGLVKYLSKFSYQNTQNKDLWNSLSDGCSMDAAAA
GVCASNKERISSSHWTKSAINDVTAIMNTWTLQKGYPLVTVTVKGRNVHLQQEHYMKSSN
FASPKGNLWHIPLTYITSKSNVIQRFLLTTRTDYIILPEEVEWIKFNVGMNGYYIVHYGE
DGWDALIRLLKENHKILSSNDRASLINSAFQLVSAGKLSITKALDLTLYLKHESENIPVH
QGLDELIPLYKLLEKRDMNETEHQLKGYIVNLFKNMIDKQSWDDEGTMSERILRSSLLMF
ACVRRYQPCVDKAKEYFMKWKHSNGTLKLPNDIKFAVYAVGAQTDVGWDFLFSKCQLPEF
NTEKQLIETVLSLSQNKERLQWLMQQGLQGDIIKTQDLPYIVVSVGRNPVGYQLAWKFLK
DNWQALVKKFDLGSHSIAHMITGVTNKYSTKAQLADVKEYFSSLDKRSSELRAVQQTIET
IEENINWMDKNLEKIIKWLQINSSGLKSA
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgatgatattcttgctatgcattttcaacattgtatctgtatttggctctgatcagcac
agtggaaaaccatattcagttactggaaatggaagcagtccatttccttggaacaaaatg
aggcttcccaagcatgtccttccagttcattatgatcttcttattcatccaaatctcacc
actctgacgtttactggattggccaaaatagagattaatattacccaagaaaccagttca
atcatcttgcacagcaaatacctccagatcaccaaagctgtcatcgaagaagccaaagaa
aatatccgtactgataaaccagtgacagttttagaatatccaccatttgagcagattgca
ctgattgtaactaaaccattgcaccttggcaactacattgttagtattgagtattctgca
aatttgtctgacagttttcatggtttctacaaaagcacatacagaactcctgaaggggaa
gtaagggtgcttgcatcaacccagtttgaaccaacagctgctcgtaaagctttcccttgc
tttgatgaacctgcattcaaagcaaaattttctgttaagatccgaagagaacccagacat
tttgcactctctaatatgcctttagtgaaatctgttaaccttaaggaatggctcatcgaa
gaccactttcagaccagcataaagatgagcacttatcttgtggcctttattgtgtcagat
tttaaatctgtttccaagattaccactcgaggagttaaggtttcagtatatactgtacca
cacaagatcaaccaagcagattatgccttggatgcagcagtgaagctcttagagttcttt
gaggaatattttagcattccatatcctttacctaaacaagacctagcagctattcctgat
tttcagtctggtgcaatggagaattggggattgactacatacagggaaactgctttgtta
tatgatcctgaaaaatccatagcatcaagtaaacttggaattactttgactatagcccat
gagcttgctcaccaatggtttggaaatctggtcaccatggaatggtggaatgatctttgg
ctcaatgaaggatttgcaaagtttatggaatttttatcagtcagggtaacccacccagaa
ctgaaagttgaagattattttttaaacaaatattttgaagccatggaagtagatgctcta
aattcttcacatccaatatctactcctgttgaagagccatctcagattctagaaatgttt
gatgatgtttcctatgataagggagcttgtattctgaacatgttacaggattacctcagt
ccagaggtgtttaaggctggacttgtgaaatacttgtcgaaattcagctatcaaaataca
caaaacaaagatctgtggaacagtttgtcagatggctgctctatggatgctgctgctgct
ggagtttgtgcaagcaacaaggaaagaatctcaagctctcactggacaaaaagtgctatc
aatgatgtaacagcaataatgaacacttggactctacaaaaaggatatccattagtcact
gtgacagtaaaaggaaggaacgtccatctgcaacaggaacactatatgaagagctctaat
tttgcttcacccaaagggaatctgtggcatattccattaacatatattaccagtaaatca
aatgttattcaaaggtttttgctgacaacaagaacagattatatcatactcccagaagaa
gtggaatggataaaatttaatgtaggaatgaatggttattatattgtgcactatggtgaa
gatggatgggatgctctgattcgtcttctaaaagaaaaccataaaatactcagcagtaat
gatagggccagccttatcaacagcgcattccaattggtgagtgctggaaagctgtccatt
accaaagctcttgatttaacattatacctaaaacatgaatcagaaaatatccctgtgcat
caaggattggatgaacttattcctttgtacaaactgctggagaagagggatatgaatgag
actgaacatcagttaaagggatacattgtcaatctgtttaaaaacatgattgacaaacag
tcttgggatgatgaaggcacaatgtcagagcgaatacttcgaagctcccttcttatgttt
gcctgtgtgcgcaggtaccaaccatgtgtggacaaagcaaaagaatactttatgaaatgg
aagcattccaatggaacactaaagttgcccaatgatattaagtttgctgtatatgctgtt
ggagcacagacagatgtgggctgggacttccttttcagcaaatgccaactacctgagttc
aataccgaaaagcaattgattgaaactgtcctcagcctcagccaaaataaagaaaggctt
cagtggttgatgcaacaagggctgcagggtgatattataaagactcaagatcttccttat
attgttgtaagtgttggaaggaatcctgtaggttatcaattagcctggaagtttttgaag
gacaattggcaggcacttgtaaaaaagtttgaccttggttcacattccattgcacacatg
attactggagtaacaaataaatattcaacaaaggctcaacttgctgatgttaaagaatac
ttcagctctttggacaaaagaagttctgagctccgtgctgtccaacaaacaatagaaacc
attgaagaaaacatcaattggatggataagaaccttgaaaaaatcatcaagtggttacag
atcaatagcagtgggttaaagtctgcttga

DBGET integrated database retrieval system