KEGG   Anolis carolinensis (green anole): 100567168
Entry
100567168         CDS       T01608                                 

Gene name
rcor2
Definition
(RefSeq) REST corepressor 2
Organism
acs  Anolis carolinensis (green anole)
SSDB
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 100567168
NCBI-ProteinID: XP_003228737
Ensembl: ENSACAG00000012368
UniProt: H9GIV3
Position
Un
AA seq 540 aa
MPSVMEKSGILSRSRSKSSTNGGGNQNSEDDSSEEEHSHDSMIRVGADYQAVIPECKPES
PARYSNKELKGMLVWSPNHCVSDAKLDKYIAMAKEKHGYNIEQALGMLLWHKHDVEKSLA
DLANFTPFPDEWTVEDKVLFEQAFSFHGKSFARIQQMLPDKLIPSLVKYYYSWKKTRSRT
SVMDRQARKLLTKKEKDDSNDELDEGRQASEGEFDALDPKKEPPYQKPLNSKPGPVKKEV
QLSQYRHHPLRARRRPPKGMYLSQEDITGLSASPDMAALTLRHLDSQLVSLKRQVQSIKQ
INSSMKQVLDGGIDTLRPPETNIKFNSRWTTDEQLLAVQAIRKYGKDFQAIAEVISNKTV
AQVKTFFVSYRRRFNLEEVLQEWEAEQDGGGLSASAQGASPPQDHKSSSASLASSEEDDE
VQITAVSRSSQQQNQQLPPPPLPAPLPLPASPRPPVAALSQPPPLLRPTLPTAPTLHRQP
PPLQQGRFLQPRLSLNQPPPLIRPATSRPAPSRGAQQHPPSLLGGAGEHPPHPPPSGSSL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgccttccgtgatggagaaatcggggatcctctccaggagccggtccaagtcgtcgacc
aacggcggtggcaaccagaactcggaagatgacagcagcgaagaagagcactcccacgat
agcatgatccgtgtgggagcggattaccaagctgtgatcccagagtgcaaaccagagagc
ccggctcgctacagcaacaaggagttgaaagggatgctcgtctggtcgccaaatcattgt
gtctctgatgccaaactggacaaatacattgccatggccaaggagaagcacggctacaac
atagagcaggcgctcgggatgttgctgtggcacaaacacgacgtggagaagtccttggcc
gacttggccaacttcacgcccttcccggacgagtggaccgtggaggacaaagtcctgttt
gagcaagcctttagcttccatggcaagagctttgctcggatccagcagatgcttcctgat
aaactgatcccaagcttggtgaagtattactactcctggaagaagacccggagcaggacg
agtgtgatggacaggcaagcccgcaagctcctgaccaagaaagaaaaggacgacagcaat
gatgaactggacgaaggacggcaggcgagtgagggcgagtttgacgctttggatcccaag
aaggagcctccttaccagaagccactcaacagcaaaccggggccggtgaagaaggaagtg
caactgtcacagtatcggcaccacccgctgcgcgcccgccggagacctcccaagggcatg
tacttaagccaagaggacatcactgggctgtctgccagcccggacatggcggctctcacc
ctgcggcacttggactctcagctggtttccctcaagcgccaggtacaaagcatcaagcag
atcaacagcagcatgaagcaagtgctggatggtggaatagacacactgcggccacctgag
acaaacatcaagtttaactcacgctggacaacagatgagcagctactggctgtgcaagcc
atccgtaaatacgggaaagatttccaggccatcgcagaggtgatcagcaacaaaacggtg
gcccaggtgaagacgttctttgtcagctaccgccgccgcttcaacctggaggaggtgctg
caggaatgggaggccgagcaggacggaggggggctgtcggcatctgcgcagggcgcctct
cctccccaggaccacaagagctccagcgcatcgctcgcgagcagcgaggaagacgacgag
gtgcagatcaccgctgtgtcccgttcctcgcagcagcagaaccagcagcttccgccgccg
cctctgcccgctccactgccactgccggcgtccccccgcccgcccgtggccgccctctcg
cagccgcctccgctgctgaggcccactctccccacggcgcccacgctgcaccgccaaccc
ccgcccctgcagcaaggccgcttcctccagcccagactctcgctcaaccagccgccgccg
ctcatccgaccggcaacctcgcgaccggcgccgtcccgcggagcccagcagcaccctccg
tcgctcctcggcggggcaggggagcaccctccgcacccgccgccctctggcagctccctc
tga

DBGET integrated database retrieval system