KEGG   Anolis carolinensis (green anole): 100567317Help
Entry
100567317         CDS       T01608                                 

Gene name
iws1
Definition
(RefSeq) IWS1, SUPT6H interacting protein
  KO
K17498  transcription factor SPN1
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acs03021]
    100567317 (iws1)
Transcription machinery [BR:acs03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100567317 (iws1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 100567317
NCBI-ProteinID: XP_003218434
Ensembl: ENSACAG00000005666
Position
3
AA seq 720 aa AA seqDB search
MNIDDGGATPVQDERDSGSDMEDNGNDQLSGSENASIGQHSENELSDGEDDSHTRGDPMT
DSENEGTPRQKHSDSENEEAPNHHASDSENEGAPISKDSDSDNEDHPVRHASDSENEDAA
NNQASDSESEEPTKGHDSDSETEEPQKHLASDSENEESHKDHTSDLENEEPEKHLGSDSE
NEEPEKNNDTDSENDVVPKPLVSDSENEGPKPQTSDSETEDVPKNKVEAESEDSSRTSKK
KEETENSAEISDSDQVGKRLRDSDSEEEEESPKKRKIADSDEEEEKEEEKSAKRKAAVLS
DSEDEETTPAKKGRIISDGEESDSDNATEKYEKQKKVLTSDSEDDDDKVDDGKKKEEKDL
FGSDSESGNEQENLIADIFGESGDEEEEEFTGFNQEDLDEEKAERKEAADDSDSDDNIKR
GKHMDFMSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVVSAMIVKMNEAAEEDRQLNT
QKKPALKKLTLLPTVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPALKIREELLK
ILQELPSVSQETLKHSGIGRAVMYLYKHPKESRPNKDMAGKLINEWSRPIFGLTSNYKGM
TREEREQRDLEQMPQRRRLSSSGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSN
KDYVVRPKWNVEMESSRFQAGSKKGVSRLDKQMRKFTDIRKKSRTSHAVKISIEGNKMPL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgatgacggtggagccacaccagtacaggatgagcgtgattcaggttcagac
atggaagataacggaaatgaccaactctctggatcagaaaatgcaagcatagggcaacat
tcagagaatgaactcagtgatggagaagatgatagtcatacaagaggagaccccatgaca
gattctgaaaatgaaggtactccaaggcaaaaacatagtgattccgaaaatgaagaggct
ccaaatcatcatgccagtgactcagaaaatgaaggtgcacctataagtaaagacagtgac
tctgataatgaggatcacccagttcgccatgctagtgactctgagaatgaggatgctgca
aataatcaggccagtgattctgagtctgaagagcctaccaaaggccatgacagtgattct
gagactgaagagccccaaaagcacttggctagtgattctgaaaacgaggaatcacataaa
gatcatacaagtgacttagaaaatgaggagccagagaaacatttgggcagtgattcagaa
aatgaagaacctgaaaaaaataatgatactgactcagagaatgatgttgttcccaaacct
cttgtcagtgactctgaaaatgaggggccaaagcctcagaccagtgactctgaaacagaa
gatgtccccaagaacaaggtggaagcagagtcagaagacagcagtagaacaagtaagaaa
aaggaggaaacagagaattctgctgaaatttcagacagtgatcaagtgggaaaaagactt
cgtgattctgatagcgaggaggaagaagaaagtcctaaaaagcgaaagatagctgacagc
gatgaggaagaggagaaagaggaggaaaaatcagcaaagaggaaagctgctgttctctct
gacagtgaggatgaagaaaccacacctgcaaaaaaaggacgaataatttcagatggtgaa
gaatccgatagcgataatgcaactgagaaatatgagaagcaaaagaaagttctgacttcg
gatagcgaggatgacgatgacaaggtggatgatggaaagaagaaggaagaaaaagatctt
tttggaagtgatagtgaatcaggaaatgaacaagaaaacctcattgcagatatatttgga
gaatctggagatgaggaggaagaggaatttacggggtttaatcaagaagatctggatgaa
gagaaagctgagaggaaagaagcagcagatgattcagactctgatgacaatatcaaaaga
ggaaagcatatggacttcatgtcagattttgaaatgatgttacaacggaagaagagcatg
agtggcaagcgccggcgcaaccgtgatggtgggactttcattagtgatgctgatgatgtt
gtcagtgcaatgatcgttaagatgaacgaagcagcagaggaagacaggcagctgaataca
cagaagaaaccagctcttaagaagttaactttgcttccaactgtagttatgcaccttaaa
aagcaggatctgaaagaaactttcattgacagtggagtgatgtcagccattaaagagtgg
ctttctccactaccagaccgaagccttccagccctgaagattcgggaggagcttctgaag
attctccaagagttgcctagtgtgagccaagagactttaaagcatagtggaattggaaga
gcagtgatgtatctctacaaacaccctaaggaatcacggcctaataaggacatggcaggg
aaactaattaatgagtggtctcggcctatttttggcctaacgtcaaattacaagggaatg
actagagaggaaagagaacaaagagatttggaacagatgccacagcgaagaaggttgagc
agctccggaggtcaaacacctcgtagggacttggagaaggtgttaacgggagaagaaaaa
gctcttcgacccggagatccaggattttgtgctcgcgctagagttcccatgccttccaac
aaggattatgtggtgaggccaaagtggaatgtggaaatggaatcttccagattccaggca
ggctctaagaaaggagttagccgcctggacaaacagatgcgcaagttcacagatatccgg
aaaaaaagcagaacatcccatgctgtgaaaatcagcatagaaggcaataagatgccgttg
tga

DBGET integrated database retrieval system