KEGG   Anolis carolinensis (green anole): 100567705
Entry
100567705         CDS       T01608                                 

Gene name
socs5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:acs04121]
    100567705 (socs5)
Ubiquitin system [BR:acs04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100567705 (socs5)
SSDB
Motif
Pfam: SOCS SH2 SOCS_box
Other DBs
NCBI-GeneID: 100567705
NCBI-ProteinID: XP_008103104
Ensembl: ENSACAG00000004259
UniProt: G1KCN4
Position
2
AA seq 532 aa
MGKVGKMWNSFKYRCQNLFNNESGNRNENLDVNSNNSSVRDKSVFVLDPVDQRSSSPLRD
VSLQLSLNPSKASSKKLQNCAAEIPQIVEISIEKESDLGAATGARLARRDSYSRHAPWGG
KKKHSCSTKTQSSLESNKRFGCCRLQRRERRYGVSSVHDTDSVSSRTVGNRSLRQRLQDT
VGLCFPVRTYCKQSKPLFSNKRKIHLSELMLEKCPFPPGSDLAQKWHLIKQHTAPVSPHS
TLFDAFDPSLASTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLA
PGMSELTGDCTSAPQGSSDLEEDTTTLCLQSRRQKQRQMSGESHSHISRQGAWKVHTQID
YIHCLVPDLLHITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNR
SLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTVSLNRTFPFSL
QYICRAVICRYTSYDGIDCLPLPSMLQDFLKEYHYKQKVRVRWLEREPIKAK
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgggtaaagttgggaagatgtggaatagctttaaatacagatgccagaatctcttcaat
aacgaaagtggaaacagaaatgaaaatttagatgtgaactccaataattcatctgttaga
gataaaagtgtttttgtgcttgatccagtggatcagcgatcaagcagccctttaagagat
gtttctttacagctgagtttaaatccttcaaaagcctcttcaaaaaaacttcaaaactgc
gctgctgaaatcccacagattgtggaaataagcattgagaaagagagtgacttgggtgcc
gccacaggagctagacttgcacgaagggattcatactcacgacatgcaccatggggtggt
aaaaagaaacattcctgttctacaaaaacacagagctctttggagagtaataaaagattt
ggctgttgtcgattgcaaaggcgagaaaggagatacggtgtgagttctgttcatgataca
gatagtgtctcaagcaggactgtaggtaatcgttctttgcggcaaaggctgcaggatact
gtgggtttatgttttcctgtgagaacttactgcaaacagtccaaacctctgttttctaac
aaaagaaagatccatctttctgaactgatgttagaaaaatgtcctttccctcctgggtca
gacctggcccaaaaatggcatctaattaaacagcatacagctccagtgagcccacactca
actctctttgatgcatttgatccgtctctggcttctacagaggatgaggaggatagactc
agagagagacgaagacttagtattgaagaaggagttgatcctcctcctaatgctcagata
catacttttgaagctaccgcacaggttaatccattatacaaactggggccaaagctggcc
cctggtatgtctgagcttacaggagactgtacttcagcaccacagggaagttctgacttg
gaggaggatacaacaaccctctgtttgcagtcacgcagacaaaagcaacggcagatgtct
ggagagagccatagccacatcagcaggcaaggagcttggaaagtgcatacccagattgat
tacatacattgccttgtgccagatttgcttcacatcactggtaatccatgctactgggga
gtgatggaccgctatgaagctgaagcacttttggaaggaaaacctgaaggtacttttttg
ctcagggattctgctcaagaagactacctcttctctgtgagcttccgtcgttacaaccgg
tctctacatgcacgcattgagcagtggaatcataattttagttttgatgctcacgacccc
tgtgtgtttcactcttcaactgttacaggccttctagaacactataaagatcctagttct
tgcatgttttttgaaccattgcttacagtttccctaaacaggactttccctttcagcctg
caatatatatgtcgggctgtaatctgccgatatacttcatacgatgggattgattgtctc
cctttgccatcaatgttgcaggacttcttaaaggaatatcattataagcaaaaagttcga
gttcgatggttggagcgggaaccaattaaagcaaaatga

DBGET integrated database retrieval system