KEGG   Anolis carolinensis (green anole): 100568122Help
Entry
100568122         CDS       T01608                                 

Gene name
cacng5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04260  Cardiac muscle contraction
acs04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100568122 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100568122 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    100568122 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    100568122 (cacng5)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100568122 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DHHC COPI_assoc DUF716 DUF4199 AgrD
Motif
Other DBs
NCBI-GeneID: 100568122
NCBI-ProteinID: XP_016851232
Ensembl: ENSACAG00000011340
Position
Un
AA seq 271 aa AA seqDB search
MKMLAFGERTFARVVARSSLLSSHWALMLLGMSTCGRKALTLLSSVFAVCGLGLLGIAVS
TDYWLYLEEGIILPQNQSTEVKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNVQLTSES
TVNVLKMIRSATPFPLVSLFFMFIGFILSNIGHIRPHRTILAFVSGIFFILSGLSLVVGL
VLYISSINDEMLNRTKDSETYFTYRYGWSFAFSAISFLLTESAGVMSVYLFMKRYTAEEM
YRPHPGFYSPRLSNCSDYSGQFLHPDAWVRG
NT seq 814 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgctagcttttggggaaaggacctttgctcgagttgtagccaggagttctctt
ttgtcctcccattgggccctgatgcttttgggaatgagcacttgtggcagaaaagccctg
actctgctcagcagcgtgtttgctgtctgcggattagggctgctgggcattgctgtgagc
accgactactggttgtatctggaggaagggatcattttaccccaaaaccagagtaccgaa
gtcaagatgtctctgcattctggcctctggagagtttgctttttggctggtgaagaacgt
gggagatgtttcaccattgagtatgttatgccaatgaatgtccagctcacatctgaatca
acagtcaatgttttaaagatgattcgatctgccactccattcccactggtcagcctcttt
ttcatgtttattggattcatcctgagcaacattggacacatccggccccacaggaccatc
ttggcctttgtgtctggaatattcttcattttgtctggattatctctggttgtgggcctt
gtcttgtacatctccagtatcaacgatgagatgcttaacagaaccaaggactccgagact
tacttcacatacagatatggatggtcctttgctttctctgctatttctttcctcctgaca
gagagcgcaggtgtcatgtctgtctacctgttcatgaagcgatacacggctgaagagatg
taccggcctcaccctggcttctacagcccacggctcagcaactgctctgactactcgggc
cagttcctccacccggacgcctgggtccgtggcc

DBGET integrated database retrieval system