KEGG   Anolis carolinensis (green anole): 100568228Help
Entry
100568228         CDS       T01608                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04060  Cytokine-cytokine receptor interaction
acs04068  FoxO signaling pathway
acs04110  Cell cycle
acs04218  Cellular senescence
acs04350  TGF-beta signaling pathway
acs04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100568228 (tgfb2)
   04350 TGF-beta signaling pathway
    100568228 (tgfb2)
   04068 FoxO signaling pathway
    100568228 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100568228 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100568228 (tgfb2)
   04218 Cellular senescence
    100568228 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100568228 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:acs04052]
    100568228 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:acs00536]
    100568228 (tgfb2)
Cytokines and growth factors [BR:acs04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100568228 (tgfb2)
Glycosaminoglycan binding proteins [BR:acs00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100568228 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2 TrmO_C
Motif
Other DBs
NCBI-GeneID: 100568228
NCBI-ProteinID: XP_003216034
Ensembl: ENSACAG00000001183
UniProt: G1K950
Position
1
AA seq 386 aa AA seqDB search
MHCYLLGVFLTLDLVTVAFALSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEEYPEP
EEVSPEVISIYNSTRDLLQEKANHRAATCEKERSDEEYYAKEVYKIDPKPSYQNANLISP
NGPTPYFRRVRFDVSAMEKNASNLVKAEFRVFRLRNPRPRVLEQRIELYQVLKNKDPASP
MQRYIDSKVVKTDAEGEWLSFDVTDTVQEWLHHRDRNLGFKISLHCPCCTFVPSNNFIIP
NKSEELEARFAGIDDYTYPSGEKLKPNRKKYSGKNPHLLLMLLPSYRLESQQSSRRKKRA
LDAAYCFRNVQDNCCLRSFYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRV
LSLYNTINPESRTPHYFVFHWENTQN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctacctcctgggcgtcttcctcaccctggacctggtgacggtggccttcgcc
ctctcgacctgcagcaccctggacatggaccagttcatgcgcaagaggatcgaggccatc
cggggccagatcctgagcaagctgaagctcaccagcccccccgaagagtacccggagccc
gaggaggtctcgccggaggtcatctccatctacaacagcacccgggacctgctccaggag
aaggccaaccaccgggccgccacttgcgagaaggagcgcagcgacgaggagtactacgcc
aaggaggtctacaagatcgaccccaagcccagctaccagaacgccaatctcatctcgccc
aatggtcccaccccctattttagaagagtgagatttgatgtctcagcgatggaaaaaaat
gcttccaacctggtgaaagctgagtttagagtctttcgcttgaggaatccaaggcctcgt
gtattggaacagcggatagagctttatcaggttctcaaaaacaaagatccagcatcacca
atgcaacgttacattgatagcaaagtagttaaaacagatgctgaaggtgaatggttatct
ttcgatgtaactgacacagtacaagaatggctccaccacagagataggaatcttggattt
aagataagtttacattgtccctgctgcacgtttgtgccttcaaataattttatcatccca
aataaaagtgaagagctagaggcaagatttgcaggtattgatgactacacatatcccagt
ggtgagaaattaaagcccaataggaaaaaatacagtgggaagaacccacatcttctgcta
atgttattaccctcctacagacttgagtcacaacagtccagtcggcggaagaagcgtgct
ctagatgcagcctattgttttaggaacgttcaagataactgctgcctgcgttcattttac
attgacttcaagcgagatcttgggtggaaatggatacatgaacctaaaggatacaatgca
aatttctgtgcaggagcttgtccctatttatggagctctgatactcaacatagtagagta
ctcagcttgtataatactatcaacccagaatctagaacccctcactattttgtatttcat
tgggaaaacacccaaaattga

DBGET integrated database retrieval system