KEGG   Anolis carolinensis (green anole): 100568252Help
Entry
100568252         CDS       T01608                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs04012  ErbB signaling pathway
acs04068  FoxO signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04140  Autophagy - animal
acs04150  mTOR signaling pathway
acs04210  Apoptosis
acs04218  Cellular senescence
acs04370  VEGF signaling pathway
acs04510  Focal adhesion
acs04620  Toll-like receptor signaling pathway
acs04625  C-type lectin receptor signaling pathway
acs04810  Regulation of actin cytoskeleton
acs04910  Insulin signaling pathway
acs04914  Progesterone-mediated oocyte maturation
acs04933  AGE-RAGE signaling pathway in diabetic complications
Module
acs_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100568252 (pik3cd)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100568252 (pik3cd)
   04370 VEGF signaling pathway
    100568252 (pik3cd)
   04068 FoxO signaling pathway
    100568252 (pik3cd)
   04070 Phosphatidylinositol signaling system
    100568252 (pik3cd)
   04150 mTOR signaling pathway
    100568252 (pik3cd)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100568252 (pik3cd)
  Cell growth and death
   04210 Apoptosis
    100568252 (pik3cd)
   04218 Cellular senescence
    100568252 (pik3cd)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100568252 (pik3cd)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100568252 (pik3cd)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100568252 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    100568252 (pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    100568252 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    100568252 (pik3cd)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100568252 (pik3cd)
  Infectious diseases
   05163 Human cytomegalovirus infection
    100568252 (pik3cd)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100568252 (pik3cd)
Membrane trafficking [BR:acs04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100568252 (pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 100568252
NCBI-ProteinID: XP_008111838
Ensembl: ENSACAG00000013317
Position
h
AA seq 1047 aa AA seqDB search
MLPGIYCPVEFWSKEANQSIQVDFLLPTGIYLTLSVSCNATLGTIKQLVWHHAQCEPFFH
MLSDPESYVFTCINQTAERQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLISSQISLL
IGKGLHEFDSLGDLEVDDFRVKMQHFCEERAARRQQLSWKAWMEYSFPVQLEPLANGLGG
RSLLQFPNKNIFVNVKFESGGESFTFQISPKEYPATLMSYAIKKQATVFRHQKINSPEDY
ALQINGKYEYLYGNHPLYQFQYIRDCLCRGLLPHLTMVHASSISALWEEQTNGISYPIKA
ASKAPPVPKKKPMSVSLWSLEQPYSIELVQGSKVNADERMKLVVQAGLYHGHEMLCKMVS
SSEVSVCSEPVWGQRLEFEINVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIA
WVNVMLFDFRDQLKTGECCLPMWSSFPDEKGELLNPMGTVQTNPNTESAASLVIRFPTIS
SNPLYYPTFEQILEQGKNGQSSFSMVEDPEEKQQLKEILERRSHTDLYEHEKDLVWKMRH
QIRDQFPHALAKLLVVTKWNKHEDVAQMIYLLQSWPELPVLNALELLDFSFPDRYVGAFT
VNSLKKLTDADLFQYLLQLVQVLKYESYLDCELTKFLLGRALSNRKIGHFLFWHLRSEMH
VPSVALRFGLILEAYCRGSTFHMKALMKQTESLNKMKALNDLIKASSQKNAKPQTKEFMH
TCMRQETYLEALSNLQSPLNPSVILAKVSVELCTFMDSKMKPLWIVFNNEDAGGGHVGVI
FKNGDDLRQDMLTLQMIQLMDILWKKEGLDLRMTPYGCLSTGDKTGLIEVVMDSDTIANI
QLNKSNMAATAAFNKDALLNWLKSKNPGDALDRAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFR
EYCERAYMILRCHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEARRHFQL
KFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgggatttattgtccggtcgaattttggtccaaagaagccaaccagagcatc
caagtggacttcctcttgcccaccggcatttacttgactctctccgtttcctgcaatgca
accctgggcaccatcaaacagctggtctggcaccatgcccaatgcgagcccttcttccac
atgctcagtgacccagagtcgtacgtcttcacctgcatcaaccagacggccgagcggcaa
gagctggaagacgagcagcggcgcctctgcgacatccagccattcttgccagtcctgcgg
ctcgtggcccgtgaaggcgaccgggtcaaaaagctgatcagttctcagatcagcctcctt
atcggcaaaggtttgcatgagtttgactctctgggagatctggaagtggacgacttccgt
gtcaaaatgcagcacttttgcgaggagagagcggcccggcggcagcagctaagctggaag
gcctggatggaatacagcttcccagtccaactggagcctttggccaatggactgggagga
aggtctctgctccagttccccaataagaacatttttgtcaacgtcaagtttgaaagtgga
ggggaaagttttaccttccagatctcgcccaaggagtaccctgcaacccttatgagctat
gccatcaagaagcaagcgactgttttccgtcaccaaaaaatcaacagccctgaagattat
gctttgcagattaatgggaaatatgaatacctctatggaaaccaccccttgtaccaattc
cagtacatccgcgactgcctctgccgcggcctccttccccacctcaccatggtacacgcc
tcctccatctcggctttgtgggaagagcagaccaatgggatttcctatcctataaaagca
gccagcaaagcacctccagtccctaagaaaaagccaatgtcggtgtctctgtggtccctt
gagcaaccttactctattgagttggtgcagggcagtaaagtgaatgcggacgagcggatg
aagttggtggtccaggcaggcctgtaccatggccatgagatgctctgcaagatggtctcc
agctcggaggtcagcgtctgctcggagccggtgtggggccagaggctggagtttgagatc
aacgtctgcgacttacctcgcatggcacggctctgcctggccctctatgcagttgtggag
aaagccaagaaggcaaggtccaccaaaaagaagtccaagaaagcggactgcccaattgcc
tgggtgaacgtcatgctgtttgatttccgagaccaactgaaaacgggagaatgctgccta
cccatgtggtcatcatttccagatgagaaaggagagctgttgaaccccatgggcacggtc
cagaccaaccccaacaccgagagcgcagcctccttggtcatccggttccccaccatttca
tccaacccactgtattatcccacctttgaacagatactggagcagggaaagaacgggcag
tcttccttctccatggtagaggatccagaggagaagcaacagctgaaggaaatcctggaa
cgcaggtctcacaccgacctctatgaacacgagaaggaccttgtgtggaaaatgaggcac
cagatccgagaccagttcccgcacgccttggcaaagctcttggttgtcaccaagtggaat
aaacacgaagatgttgctcagatgatctatttgctgcagtcctggccagagttgcctgtc
ctcaatgccctggagctgttggatttcagttttcctgatcgctatgtaggagccttcaca
gtcaactcactgaaaaaacttacagatgccgacttgttccaatacctcttgcagctggtc
caggtgctgaaatacgagtcctatttagactgcgaattaaccaagttcctcttgggccgg
gccttatccaaccgcaagattgggcacttcctcttctggcacctcaggtcagaaatgcat
gttccttctgtcgccttacgattcggcctgatcctggaggcctactgccgaggaagcacc
ttccacatgaaggctctgatgaaacagaccgaatccctcaacaagatgaaggcactcaat
gacctcatcaaagccagttcccagaagaatgccaagccccaaaccaaggagttcatgcac
acctgcatgcggcaggagacctacctggaagccctctccaacctccagtctcccttgaac
cccagcgtcattctggccaaagttagcgtggagctatgcactttcatggattcgaagatg
aagccgctgtggatcgtgtttaataacgaagacgctgggggaggccacgtgggtgtcatt
tttaaaaatggagacgaccttcgtcaggatatgttgaccctgcaaatgatccaactcatg
gacatcctgtggaagaaagagggcctagacttgcggatgaccccgtacggctgcctttca
acaggagacaagaccggattgatagaagtggtcatggactcggacaccattgccaacatc
cagctcaacaagagcaatatggccgccacagccgccttcaacaaggatgccttgttgaat
tggttgaaatccaagaaccctggtgatgccttggaccgggccattgaagagttcacgctt
tcctgtgctgggtattgtgtggccacctacgttttggggattggagaccgtcacagcgac
aacatcatgatccgagagaatggccagctgtttcacattgattttggccacttcttgggg
aacttcaagaccaagtttgggatcaatcgcgagcgggtccctttcatcttgacctatgac
ttcgttcacgtgatccaacaagggaaaacgaacaacagcgagaagtttgaacgattcaga
gagtactgtgaaagggcctacatgatcctccggtgccacggtctgctcttcctacacctg
tttgccctcatgaaagctgccgggttgcctgagctgagctgctccaaagacatccaatac
ctcaaggactccctggccttgggaaagaccgatgaagaagccaggagacacttccagctc
aagttcaatgaagctctccgggaaagctggaaaaccaaagtgaactggctggctcacaac
gtctccaaagacaaccggcaatag

DBGET integrated database retrieval system