KEGG   Anolis carolinensis (green anole): 103278866Help
Entry
103278866         CDS       T01608                                 

Gene name
cacna1i
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
acs04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103278866 (cacna1i)
   04020 Calcium signaling pathway
    103278866 (cacna1i)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acs04040]
    103278866 (cacna1i)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103278866 (cacna1i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103278866
NCBI-ProteinID: XP_008108930
Ensembl: ENSACAG00000007474
Position
5
AA seq 2174 aa AA seqDB search
MKVHIKSLPSQHFTGGQTTSECGKYGKKLLMKKNKQGFSFHADMAEHGGTHSPTPWHSGS
PATHNPTLCPLEHMDMGISEQSSPLEQPPPSPDLGDDDDDGDMEPVPDPDVPYPDLASVV
FFCLRQTTRPRSWCIKMVCNPWFECLSMMVILLNCVTLGMYQPCDDMDCLSNRCQILQVF
DDFIFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIR
TVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNR
CFMEENLTIQGNITLPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKERGHVCCLDKD
DYFYYTSVRQEFNVSGMCVNWNQYYSECRTGNANPHKGAINFDNIGYAWIVIFQVITLEG
WVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQRAR
YLSSSTVASYMEPGDCYEEIFQYVCHIVRKAKRRTLGFYNSLQDRRLGRTEPSTAKRNIK
EKDQRQYRRCRKHNSADYMPSQGLGQPIAVTLTSDPSNCPRCHKVQREAARRLSVLESAD
SEQEDGGGPTEEKGDGKKGSVEAADLEKEEEEGEEGGQVAICSDVWQEVRVKLRGIVESK
YFNRGIMIAILVNTISMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYL
RNPYNIFDSIIVIISIWEIIGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMD
NVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQVSPE
QEKRKALRYDLQSKKWGLICHWGGLMGVVVQGQQEGHRMYTPDEVEEEKLKRDNFRCDSL
NENVDSSKFPVWVEILNPILALSQSSSRSTHYGAWSRTGGWGSRRSSWNTLARGHSLKHK
PPSAEHESLLSGDRQRTLEGEREVPVRIHHHRRTLSLDIKGTSELVELVPSTVSCHRPSR
KTGVTTGPTEHQDCNGKMPNIAKDIFPEMNNRKDHGEDEDETDYSLCFRIRKMIEAYKPD
WCELREDWSIYLFSPQNKFRILCQTIIAHKLFDYVVLSFIFLNCITIALERPQIEHGSTE
RIFLTVSNYIFTAIFVAEMTLKVVSLGLYFGEQAYLRSSWNILDGFLVFVSIIDIVVSVA
SAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIF
GILGVQLFKGKFYHCLGVDIRNITNRSDCMAANYKWVHHKYNFDNLGQALMSLFVLASKD
GWVNIMYNGLDAVAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQH
QEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCSVRLLIHSVCTSHYLDIFITFIICLN
VVTMSLEHYNQPMSLETALKYCNYMFTAVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVL
LSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVG
NLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNW
NGIMKDTLRDCTHDDRSCLSNLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEA
QEDAEMDAEIELEMAHGMYPHSSLNPGQDGGGGRMDPEGHLCMACFSPDQENLWLDSVSL
IIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCNHDKQEVQLAEMEGLSLNSDKSSVLLG
DDEDNQSGDLPSPRETKDGEDSPNSTGIVPVEECLFPLTSTDASPAPESYLCEMEKIPFS
PVQSWLTNESNQDPPSLFSPDASHPLLPVPAEHFLPAVSASQQSQEEASCPETLPKISLQ
ASWASLQSQNVNCSLIHQTTGSDTSLDDSRSNSSEGSLQTTLEDSLNLSDSPQCALDLPV
ALCPVPATATQKALAAPLSPASRRQSLRGRGIFTLRNIRRHQRSHSSGGSTSPGCPYHDS
MDPSDEEGAGSSLKGGGNNNEQSETLSSLSLTSLFSPPPPPQGLSLIKKCSSTSSLHANS
SSQGSAATETKQFYSVDPRGFLSMPSWMTDFYKNSPSTREGSMAEGSGRIGTADRSSPIP
SELQLGSGVSKRNR
NT seq 6525 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacacattaagtccctgccatcccaacattttacaggtggtcaaacaacatcg
gaatgtgggaaatatggcaaaaagttactaatgaagaagaacaaacaagggttttcattc
catgccgacatggcagaacatggtggtacccactcaccgactccctggcattcggggagc
ccagccactcacaaccccactctgtgccccttggaacatatggatatgggaattagtgag
cagtcatctccactggaacaaccaccaccgtcccctgacctgggagatgatgatgatgat
ggcgacatggaacctgtgccagacccagatgtgccctaccctgatttggcttccgtagtt
ttcttctgcttgagacaaactaccaggcctcggagctggtgcatcaagatggtgtgcaat
ccttggtttgaatgtcttagtatgatggtgatcctactgaactgtgttactcttgggatg
taccagccctgtgatgatatggattgcctttccaacagatgtcaaattctgcaggtattt
gatgacttcatcttcatcttctttgcaatggagatggtcctgaagatggtagccttgggg
atctttggcaaaaaatgctaccttggagacacctggaaccgcctggatttctttattgtc
atggctgggatggtggagtattctctggatctccaaaatatcaacttgtctgcaatacgc
actgttcgagtcctgaggcctctcaaagccatcaaccgtgtgcctagcatgcgtatcttg
gtgaatctgctcttggacactctgcccatgctggggaatgttctgcttctctgtttcttc
gtcttcttcatctttggcatcatcggagtacagttatgggctggtctactgagaaaccgc
tgtttcatggaggaaaatctgactatacaaggtaacatcacccttcctccctattatcaa
cctgaggaggacgacgaaatgcccttcatctgttcactatcaggagataatggcatcatg
ggctgccatgagattcccccactgaaggagcgaggccatgtatgctgtttggacaaagat
gactatttctactacacttctgtcagacaggagttcaatgtcagtggcatgtgtgtcaac
tggaatcaatattacagtgaatgtcgcacaggcaatgccaatcctcataaaggggccatc
aactttgacaacatcggctatgcatggattgttatatttcaggtgatcactctagaaggc
tgggtggagattatgtactatgtgatggatgctcattcattctacaacttcatctacttc
atcttgctgatcattgtgggctcattcttcatgatcaacctgtgcttagtggtcattgct
acacagttttcggaaaccaagcagcgagaacaccagctgatgcaggagcagcgagcccga
tacctgtcctccagcactgtggcgagctacatggagccaggagattgctatgaggagatc
tttcagtatgtctgccatattgtccgcaaagccaagcgccgcacccttggcttctataac
agcctgcaggacagacgcctaggtcggacagagccaagcactgccaagcggaacatcaag
gagaaagaccagaggcaatacaggcgctgccgaaaacataactctgctgattacatgccc
tcacaaggccttggccagcctattgctgtgactctgacctctgatcccagcaattgtcca
agatgtcataaggtccagcgggaagcagctcggagactttccgtccttgaaagtgctgat
tcagaacaagaagatggtggaggacccacagaggagaagggagatggcaagaaaggaagc
gtggaagctgcagacctagagaaagaggaggaggagggagaagaaggtggccaggtggcc
atctgcagtgacgtgtggcaagaagtgagggtcaaactgagaggaatagtagagagcaaa
tatttcaaccgtggtatcatgatcgccatccttgtgaacaccatcagcatgggcattgaa
catcatgagcagccagaagagctgaccaacattttagagatctgcaatgttgtgtttacc
agcatgtttgccctggagatgatcttgaaacttgctgcctttggtctgtttgattatctc
cgcaacccttacaacattttcgacagcatcattgtcattatcagcatctgggagatcata
ggccaagctgatggaggtctgtcagtgttgaggacatttcggttgctgagggtgttgaag
ctggtcaggttcatgcctgccttacggcgtcagctggtggtgctaatgaagactatggac
aatgtggctaccttctgcatgcttcttatgctgtttattttcatattcagcatcttggga
atgcacatctttggctgtaaattcagcctcagaactgacacaggagatacagtccctgac
cgaaagaattttgactccctcctttgggccattgtcactgtgtttcaggtgagtccagaa
caggaaaagaggaaggcgctgaggtatgacctacaaagcaaaaagtggggtttgatctgt
cattggggagggctgatgggggttgtagtccagggacaacaggaagggcacagaatgtac
acccctgatgaagttgaagaagagaaactcaagagggataattttagatgtgactccttg
aatgaaaatgtggactcatccaagtttcctgtttgggtggagattctgaatcctatcttg
gctctctcacagtctagctctcgcagtactcactatggagcatggagtcgtacagggggc
tgggggagtcgacgctccagctggaatactcttgcacgggggcatagcctcaaacacaag
cctccttcagctgagcatgagtcgctcttatctggagataggcagaggacattagaggga
gaacgagaagtaccagtaagaattcatcaccatcgacgaacgctctccttggatatcaaa
ggcacttctgaactagtggagttggtgccatcaacagtgtcttgtcataggccatcacgg
aaaacaggtgtgacaactgggcctactgagcatcaagactgcaatggtaaaatgcccaat
attgctaaggacatctttccagaaatgaacaatcgcaaggaccatggagaagatgaggat
gagacagactatagcctgtgtttccgtatcagaaagatgatagaagcctacaagccagac
tggtgcgagttgcgggaggattggtccatctatctcttctcaccacaaaacaagtttcgc
atcctctgtcaaactatcattgcccataagctgtttgattatgttgtgctgtccttcatt
ttcctgaactgcatcaccattgcactggagagacctcagattgagcatgggagtactgaa
agaatcttcctcacggtatccaattacatcttcacagcaatctttgttgctgagatgaca
ctgaaggtagtctcccttggcctatattttggggagcaggcctatctccgcagcagttgg
aatatccttgatggcttcctggtgtttgtatccatcattgatattgtggtttcagttgca
tctgctgggggagccaagattctgggggtgctgcgcgttctccgactactccgcactttg
cgtcccctcagggtcatcagccgtgctccaggcctgaagctggtggttgagacgctgatt
tcatcactcaagcccattggaaacattgttctcatttgctgtgctttcttcatcatcttt
ggcattcttggagtgcagctcttcaagggaaagttctaccattgtctgggggtggacatc
cgaaatatcaccaacaggtctgactgtatggctgccaattacaaatgggtgcatcacaaa
tacaatttcgacaatctgggccaggcattgatgtcgctctttgttctggcttccaaagat
ggctgggtcaacattatgtacaacggtctggatgctgtggctgttgaccagcagccagtg
accaacaacaatccttggatgctcctttacttcatttctttcttgctcatcgtcagcttc
ttcgtgctcaacatgtttgtgggggttgtagtagagaactttcacaaatgccgtcagcat
caagaggcagaggaagctcggcggcgtgaggagaaacgcctgaggcgcctggagaagaag
cgcaggaaggcccagcgtttgccatattatgccacctattgctctgtccgccttctcatc
cattcggtctgcactagccattatttggatatcttcatcaccttcatcatttgcctcaat
gttgtcaccatgtccctggagcactacaaccagccaatgtctctggagactgccctcaaa
tactgcaactacatgttcactgcagtctttgtgctggaggcagttttgaagcttgtggcc
tttgggctgagacgcttcttcaaagacaggtggaaccaactcgatctggccattgtcctc
ctctcggtcatgggcatcaccctggaggagattgaaatcaatgctgcccttcctatcaat
cccaccatcatccgcatcatgagagtcctgcgcattgctagagttttgaagctcttgaag
atggcaacagggatgcgagctttactggacacagttgtgcaagccctgccacaggttgga
aatcttggactgctattcatgctcctttttttcatctacgctgctttgggagtggagctc
tttgggaaacttgtatgcaatgatgagaatccctgtgagggcatgagccgtcatgctacc
tttgagaactttgggatggctttcctcacacttttccaggtctccacaggtgacaactgg
aatggaataatgaaggacacactgcgtgactgcacccatgatgaccggagttgcctcagc
aacctgcagttcatctcaccactgtactttgtcagctttgtgctcaccgcccagtttgtc
ctcatcaatgtagtagtagctgtgctcatgaaacatctagatgacagcaacaaggaagct
caagaagatgcagaaatggatgctgagattgagctggagatggcacatgggatgtatcca
catagctcactgaaccctggacaagatggaggaggtggaagaatggaccccgaaggacat
ctgtgcatggcatgcttctctcctgaccaggagaacttatggctggacagtgtctcttta
attattaaggactccttcgacggggagttaatgatcatcgataacctatcgggctccgtc
ttccatcattactcctcgccggccatgtgcgagaagtgtaaccatgacaagcaagaggtc
cagctggctgaaatggaaggcttatcccttaactctgacaagtcgtctgtcctccttggg
gatgatgaagataaccagagtggggatctgccaagccccagggaaacaaaggatggtgag
gacagccctaactccacggggattgtacctgtggaggaatgtctcttccctttaacaagt
acagatgcttctcctgctccagaaagctacctttgtgaaatggaaaaaatccctttcagt
ccagtccagtcttggctaacaaatgagagcaaccaagatcctcccagcctcttctctcca
gatgcatctcatcctctgttgcctgtaccagcagagcatttccttccagctgtttctgcc
agtcagcaaagtcaggaggaagcttcctgcccagagactctccctaaaatctctctgcag
gcttcttgggcttcactacagtctcaaaatgtgaactgttcacttattcatcagaccaca
gggagtgacacctccttagatgacagcaggagcaacagttcagaaggaagtctgcagacc
acactggaggacagcttaaacctcagtgactcaccccagtgtgccctggacctcccagta
gcactgtgtccagtgccggcaacagccacccaaaaagccttggccgcaccgctttcccct
gcttctcgaaggcagagtttaaggggacgtggaatcttcactcttcggaacatcaggcgg
caccagcgtagccacagcagcggaggaagcactagtccagggtgcccttaccatgactcc
atggacccttctgatgaggagggtgccggaagcagcctaaagggtggaggcaacaataat
gagcagtcagagaccctcagcagcctctctctgacttctctcttctcaccaccccctcca
ccccaaggtctgtcactgataaagaagtgcagcagcaccagcagtctccatgccaactct
tcttcgcagggttctgcagcaacagaaaccaagcagttctactcagttgacccaaggggt
tttttatccatgccctcatggatgacggatttctacaagaatagcccttctactagagag
ggcagtatggcagagggctcaggcaggattgggactgcagaccgcagctccccaattcct
tctgagttgcagctgggaagtggagtcagcaagaggaatagatga

DBGET integrated database retrieval system