KEGG   Anolis carolinensis (green anole): 103278984
Entry
103278984         CDS       T01608                                 

Gene name
akap5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acs01009]
    103278984 (akap5)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     103278984 (akap5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 103278984
NCBI-ProteinID: XP_008110209
Position
1
AA seq 486 aa
MEDTEKTVQMESPQKPEALDGPKFAITNQSPAKKASVFCFKKRKKSCEKVAEKEEDGESE
TLTLKPVSQDSNTGSSGAELSGSLWTSGGAWLAFKRLVTSRRRSKSVLKKQQQSGGSRVQ
LESQAEDSGVLPCPKERAGLKIPCLRFSRSRKKATNCELSEELDHGEKANEKTSILNDQS
NCEEPEVLALEGPLSAQRSSSSEALEETKGDTDIVKNGGNVVNSSTDKVFAVDIGPGPDC
YADDVVQSEIIHSEKVLETEEEKQIFQLHQGSLYGDPEEAEDRFNFKVEIGPPIPEILPG
AELGVFKTEEVKEAELGKEVDTTTNGSSAKEGNSVEVMLHCSPPAMGEEASDVPVGSDEE
TKENQPVMPAAGIMIMITEAEEWPDEEEPNQACELFSLAQVNKQKGKKKSKKGADSGGHD
HTRDGKPSSKVWPALSGTDQEHWTSEQYEGLLIETAASLVKAAIQSSIEQLVNEMALEQN
KQNSFL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggaagatacagagaaaacagttcagatggagagccctcaaaaaccagaagctctggat
gggccaaagtttgccatcacaaaccagagcccggccaaaaaggcctcagtcttttgtttt
aagaaaaggaagaagtcctgtgaaaaggttgcagagaaggaggaagatggtgaatctgag
acacttactttaaagcctgtaagccaggactccaacacgggaagtagcggagcagagcta
tcaggttccttatggacgtcaggaggagcttggttggccttcaaacgcctggtgacttca
aggagacgatccaagtctgtcctaaagaagcagcaacagtcaggaggttcccgtgtccaa
ctggagtctcaagcagaagactcaggggtgctgccttgcccaaaggaacgagctgggttg
aaaatcccctgcttgaggttctccagaagccggaagaaggccactaattgtgaactttct
gaagagctggatcatggagagaaagcaaatgaaaagacaagtattttgaatgaccaaagt
aactgtgaggaaccagaggttctggctctggaaggtccactgagtgcccaacggtcctcc
tccagtgaagcccttgaggagacaaagggcgatactgacattgttaaaaatgggggcaat
gtggtcaactcaagtacggataaggtctttgcagtagatataggtcctggtcctgattgt
tatgcagatgatgtggtccagtccgaaatcatccactctgagaaggtcctcgaaaccgaa
gaggagaagcaaatcttccagttgcaccagggcagcctctatggagacccagaagaagca
gaagacagatttaatttcaaggttgagatagggcctcccattcctgagatcttgccagga
gctgaacttggagtcttcaaaacggaggaggtcaaagaggcagagttggggaaggaagtt
gacactactacaaatggaagcagtgccaaagagggaaactctgttgaagtgatgctacat
tgcagcccacctgccatgggagaggaggcttcagatgtgccggtcggttctgatgaagaa
acaaaagaaaatcaacctgtcatgccagcagcgggcatcatgatcatgattacagaagcg
gaggaatggccggatgaagaggaacccaaccaggcctgtgaactcttctcgttggcacaa
gtcaacaaacagaaagggaagaaaaaatcaaaaaaaggtgctgattcagggggtcatgac
cacacaagggacgggaaaccgtcttccaaggtctggccagccttgagtggaactgaccag
gaacactggacttcagagcaatatgaagggcttctgatcgaaacggccgcatcgctggtt
aaggcagccatccagtcgtccattgagcagctggtgaacgaaatggcgttggagcaaaac
aagcagaacagcttcctatga

DBGET integrated database retrieval system