KEGG   Anolis carolinensis (green anole): 103280904
Entry
103280904         CDS       T01608                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:acs03036]
    103280904
Chromosome and associated proteins [BR:acs03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103280904
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 Herpes_capsid
Other DBs
NCBI-GeneID: 103280904
NCBI-ProteinID: XP_016853138
Position
Un
AA seq 464 aa
MTLLVPLSLPSPSKPRRQSSAKVRPKEVHYAASVGNVHWLQMCLQKAENPTQADINGFSA
LHTSALRGRLDCIQVMVEKYSVDVNLPSATGWCPIHLVLSKENGPRALECLTFLLSKGAD
VNAPSFPPSAAYAADSCRKRASETARCGVGRLYFVSEGEFLVAHKTTNPCRSLENAMWKV
EKDKVAKEMCKLDRIKADCEARRMQFLQTEQTEVDVSNAVAFDSWLAKKRLRPPSNRILS
YLERKRPSASLRKLSKGTVSPRPSVALPVPKEEAPSQERGLQPWNPSTSLSSRPATRISR
PTIVRLGVEPEEAAAPDFSSFLFLVRNAFGGPKIHMGRAGTVPYVPDLPFEELKRGLLPQ
RWAPRPRLHLPRDLRPMDIQVQKHKRPPEPQHRWTDQLALSLRQTLDAGSARTLRAHHGL
FATGGPSPPRRGSGQGKGAATSSSSSSSSSYSASLLSKTSICQE
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgactctgcttgtgcctctgtccctccccagcccctccaagcccagaaggcagtcttcg
gcgaaggtccggcccaaagaggtccactacgcggccagcgtggggaacgtgcactggctc
cagatgtgcctgcagaaagctgagaaccccacccaggccgacatcaatggcttctctgcg
ctgcacacgtcggctctgcgcgggcgcctggactgcatccaggtcatggtggagaagtac
agtgtggacgtgaacctccccagcgcgaccgggtggtgcccgatccacctggtgctgagc
aaggagaacgggccccgggccctggagtgcctcacgttcctcctcagcaaaggggccgac
gtcaacgccccttcctttcccccctcggccgcttacgcggccgattcctgcaggaaaagg
gcctcggagactgcgcgctgtggagtcggacgtttgtattttgtctctgagggagaattc
ttagtggctcacaaaactacaaatccctgcaggagcctcgagaacgccatgtggaaagtg
gagaaggacaaagtcgcaaaggagatgtgcaaactggacagaatcaaggcggactgtgag
gcgaggagaatgcagttcctccagacagagcagacggaggtggacgtgtccaacgccgtg
gcctttgacagttggctggccaagaagcgcctgcggcctccgtccaaccggatcctgtct
tacctggaaaggaagcgcccgtccgcctctctcaggaagttgtccaaggggacggtcagc
cccaggccgtccgtggccctgccggtcccgaaggaggaggccccctcccaggagcgtggg
ctccagccgtggaaccccagcaccagcctctcctcccggccggccacccgcatctcccgg
cccaccatcgtccggctgggggtcgagccggaggaggccgcggccccggacttctcctcc
ttccttttcctcgtccggaacgcctttgggggccccaagatccacatgggccgtgcgggg
acagtcccctatgtgccggacctgccctttgaggagctgaagcgtggcctgttgccccag
cgctgggccccccgcccccgcctccacctccccagggacctgcgccccatggacatccaa
gtccagaagcacaagcggcccccggagccccagcaccgctggacggaccagctggccctc
agcctgcggcagacgctggacgcgggctctgcgcgcaccctcagggcccaccacggcctc
ttcgccacggggggcccctcccctcccaggaggggctctggccaaggcaaaggggccgcc
acgtcttcctcctcctcctcctcctcctcgtactctgcttccctcctgagcaaaaccagc
atctgccaggaatag

DBGET integrated database retrieval system