KEGG   Anolis carolinensis (green anole): 103281876Help
Entry
103281876         CDS       T01608                                 

Gene name
qsox2
Definition
(RefSeq) quiescin sulfhydryl oxidase 2
  KO
K10758  thiol oxidase [EC:1.8.3.2]
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103281876 (qsox2)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     103281876 (qsox2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_SOX QSOX_Trx1 Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 103281876
NCBI-ProteinID: XP_008122395
Position
Un
AA seq 481 aa AA seqDB search
MIDFLQNHSQEAKPPACPSLEPIVPQEMFTLFDKKIQHYTAIIFESENSYAGREVMLDLI
AYDNVSVKRVLDSDPVFLEKLGISSLPSLYLICPNGTHGLRNVLKPLRSFFSSYLKSLPD
VRRRSPPRLPTLAGRDGEGDGAGVKDWKDFDPSKVYMADLESGLHYLLRVELATHKTLEG
SELRTFKSLIALLAKLFPGPDPTVKLLETLHVWLVSLPLDRIPYNAVLDLLDNKMRMAGL
FLPSRVRWIGCQGSRAELRGYPCSFWTLFHVLTVQAATQPNALLNTGLEGDPRAVLEVMR
KYVRDFFGCRACAQHFEEMAKGSLGSVQTPEEAALWLWEKHNEVNARLAGDLTEDPKFPK
APWPSLEACPSCRRGGSVSRKGQLPVWDETEVLRFLRRHYGSGNVEYRYAESRPDAEKAG
SPEEGREEERKARGSFLGFSSLDMSLCIALYGTSSLFLILLFVFFRMRSRRRKARPGRPH
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttcctgcagaatcattcccaggaagccaaaccacccgcttgtccctctttg
gaaccaattgtgccacaagaaatgtttactctttttgataagaagatccagcattacacc
gccattatttttgagagcgagaactcctacgccgggcgagaggtgatgctggatctcatt
gcgtacgacaacgtgtcagtcaagcgggtgctggactcggacccggtcttccttgagaaa
ctaggcatctcctccctcccttcgctctacctcatctgccccaatgggacccacgggctg
aggaacgttttgaagcctcttcggtctttcttttcttcctatttaaagtctctccccgac
gtccggcggaggtcgcccccgcggctcccaacgctggccgggcgggacggagagggcgac
ggcgcgggcgtcaaggactggaaagactttgacccgtccaaggtgtacatggccgacctg
gagtcgggcctgcactacttgctccgggtggagctggccacgcacaagaccctcgagggc
tccgagctgcggaccttcaagagcctcatcgccctcctcgccaagctctttcctggcccg
gatcccactgtgaagctgctggagacgctgcacgtctggctggtgagcctccccttggac
aggatcccctacaacgccgtcctcgatctcctcgacaacaagatgcggatggcgggtctc
ttcctgcccagccgtgtccggtggatcgggtgtcagggcagccgggcagagctgaggggc
tacccctgctccttctggacgctcttccacgtgctgaccgttcaggcggccactcagccc
aacgccttgctcaacacgggcctggagggcgacccccgggcggtcctggaggtcatgcgc
aagtacgtccgggatttcttcggctgccgcgcctgcgcacagcactttgaggagatggcc
aaggggtccctggggtccgtgcagacgcctgaagaggccgccctgtggctctgggagaag
cacaacgaggtcaacgcccggctggcaggggatttgacggaagaccccaaatttccgaag
gcgccgtggccatccttggaggcctgtccttcctgccgcagaggcggaagtgtttcccgg
aaaggccaacttcccgtttgggacgagaccgaggtcctgcgcttcttgaggcggcactac
gggagcgggaacgtcgagtaccgatacgcggagagccgtccggacgcggagaaggcgggt
tcgccggaagagggtcgggaggaggagcggaaggcacggggctccttcctgggcttctcc
agcctggacatgagcctctgcatcgccctctacggcacctcctccctcttcctcatcctc
ttgttcgtcttcttccgcatgcgctccaggcgccggaaagccaggcccggccggccccac
gtctag

DBGET integrated database retrieval system