KEGG   Aspergillus clavatus: ACLA_001720Help
Entry
ACLA_001720       CDS       T01148                                 

Definition
(RefSeq) thymidylate kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
act  Aspergillus clavatus
Pathway
act00240  Pyrimidine metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACLA_001720
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     ACLA_001720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylate_kin KTI12 Resolvase AAA_35 AAA_18 CPT AAA_28 PPK2
Motif
Other DBs
NCBI-GeneID: 4708622
NCBI-ProteinID: XP_001276187
UniProt: A1C4Z3
AA seq 221 aa AA seqDB search
MGNMQKRGALIVVEGLDRAGKSSQCERLRDSLQASGYSVKYIRFPDRTTPIGQLINGYLQ
GQSHLDDHSIHLLFSANRWEIARTIENDIANGVTVIVDRYSYSGAVYSAAKGNQNLSLEW
AWQPEIGLPQPDICLFLRISPEEAAKRGGFGIERYENEKMQSRVRELFQTLFKLQLGDYI
HMVDAGRTLDAVSQDILQTVTACLETIDATAPLKRLGPIAN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatatgcaaaagcgcggagcccttattgtagtggaagggctggatcgagctggc
aaatccagtcagtgtgaacgccttcgcgactcactacaagcatcagggtactccgtgaag
tatattcgtttcccagatcgtactaccccaatcggccagttgataaatggctatttacaa
ggccagtcgcatcttgacgatcattccatccaccttttgttttcggcaaatcgctgggag
atcgcgagaaccattgagaatgatatagccaatggcgtcaccgtcatagttgaccggtat
tcttattccggcgctgtttactcggctgcaaagggcaaccaaaatctgtcccttgagtgg
gcatggcaaccagaaatcggcttgccgcagcctgatatatgcttatttcttcgtatttct
cctgaagaggcggcaaagcgcggtgggttcggtatcgagcggtatgagaatgaaaagatg
cagagccgcgtgcgcgagctattccaaacgctctttaaattgcagcttggtgattatatc
cacatggtcgacgctggacgaacacttgatgcggtgtcgcaggatattctgcagacagta
acggcctgtctagagacaattgacgccactgcacctctgaagagactgggcccaattgca
aactag

DBGET integrated database retrieval system