KEGG   Aspergillus clavatus: ACLA_003260Help
Entry
ACLA_003260       CDS       T01148                                 

Definition
(RefSeq) a-pheromone processing metallopeptidase Ste23
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:act01002]
    ACLA_003260
Enzymes [BR:act01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     ACLA_003260
Peptidases and inhibitors [BR:act01002]
 Metallo peptidases
  Family M16: pitrilysin family
   ACLA_003260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 4708490
NCBI-ProteinID: XP_001276340
UniProt: A1C5E6
AA seq 1156 aa AA seqDB search
MPPRSSAALRLCYYRGLAYPGPRYFPSLSLVSTLASAAIAPPFSSSLRLRPICSLHPLPG
SWTRRSFSRSACAPFSAGNLTMGSIEHLTESLEKPELDDRSYRVIRLPNKLEALLVHDPD
TDKASASVNVNVGNFSDADDMPGMAHAVEHLLFMGTKKFPKENAYNQYLASHSGSSNAYT
AATETNYFFEPSSPLYGALDRFAQFFVSPLFLESTLDRELRAVDSENKKNLQSDLWRLMQ
LNKSLSNPGHPYHHFSTGNLKTLKEDPEKRGLEVRSEFIKFYEKHYSANRMRLCVLGRES
LDELEKWVEELFSEVENKDLPQNRWDDVQPWRPEDLGVQIFAKPVMDNRSLDIYFPFLDE
EYLYESQPSRYISHLIGHEGPGSILAYIKAKGWANGLSAGVMPICPGSAAFTISIRLTKE
GLQQYREVAKVVFEYIAMLKEREPQQWVFDEMKNLAEVEFRFKQKSPASRFTSRLSSVMQ
KPMPREWLLSGSLLRKFDPELIKKALACLQPDNFRMIVVSQEHPGDWDSKEKWYGTEYKV
QKLPQDFMADIKNALATTPETRLSELHMPHENEFVPTRLSVEKKDISEPAKTPKLIRHDE
HVRLWFKKDDRFWVPKGTVHITLRNPLAWATPANLVKSKLYCELVKDALVEYSYDAELAG
LDYHLSASVFGLDISVGGYNDKMAVLLEKVLTSMRDLVVNPDRFHIIKERLSRGYRNAEY
QQPFYQVGDYTRHLTAEKTWINEQYAAELEHIEPEDISNFFPQLLQQNHVEVLAHGNLYK
EDALRMTDLVENVLQSRPLPQSQWHVRRNIIIPPGSNYVYERTLQDPANVNHCIEYYVYV
GSIRDDILRAKLLLFAQMTDEPAFDQLRSKEQLGYVVWSGARYSATTIGYRVIIQSERTA
EYLESRIDNFLIQAGETLENMSDKDFEGHKRSVVNKRLEKLKNLSSETSRFWSHIGSEYF
DFVQNETDAANVRTLTKADIVDFYKQLIDPRSPTRGKLSIYLNAQAGGHTHTIDPKEQRS
QLVSLFGKQLETAGFAVDTERFGSVFESVDVSAGNTEQILSVLKAFLTSEMSLSEQQVAP
VLEQAKQNIGLHAKQLGIEAVDQDSKPLTNGTGKAQDKQKVTYITNVPDFKASLSMSAGP
LAATDLTEFEDFDAKL
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaggtcctctgcagctctccgcctgtgctactacagaggtctcgcatacccc
ggtccgcgttattttccttccctttctcttgtatctactctcgcctctgcggcgattgcc
cctcctttctcttcttcgctacgactgcgcccgatttgttctctgcatccactaccaggc
tcgtggacccgtcgctccttttcccgatccgcttgcgctcctttctcggctggaaattta
acgatgggttcgatcgaacatcttacggagagcctggagaagccagagctggatgatcgc
tcttatcgggttatacgcttaccaaacaagctggaagccctcctggtccatgatcctgat
accgacaaggctagcgcatctgtcaatgtcaatgtcggaaacttttcagatgcagatgac
atgccaggaatggctcatgcagttgagcacctgctgttcatgggaacaaagaagtttccc
aaagagaatgcctacaaccaatacttagcctcgcactctggctcgtcaaacgcctacacg
gctgccactgaaaccaactattttttcgaaccttcatccccactatacggcgcgctcgat
cgctttgcccagttctttgtttctcctctgttcttagagtcgacgctggatcgcgaattg
cgggccgtggattcggagaacaagaagaacctccagagtgatctatggcggctgatgcag
ctgaacaaatctctgtccaacccgggtcatccgtatcaccacttctccaccggcaacctg
aagaccctgaaggaagatcctgagaagcgtggtctggaggtccgcagtgaattcatcaaa
ttctatgaaaagcactattcggcaaaccgaatgaggttgtgtgtccttggacgagagtcg
ctggatgagctcgagaaatgggttgaggagctgttctccgaagtggagaacaaggatctg
ccgcagaatcgttgggatgacgttcaaccatggcggcctgaggacctaggtgtgcagatc
ttcgcgaaaccggtcatggataatcggtcgctggatatctacttcccattcttggatgag
gaatatctgtacgagtcccagccaagtcggtatatcagtcacctgatcggtcatgaaggc
cctggtagcatcttggcttatatcaaagcaaagggatgggccaatggcctgtcggccggc
gtcatgccgatttgtccaggatctgccgcattcacaatctcaattcggctgaccaaggag
ggcttgcagcagtatcgtgaagtcgccaaggtggttttcgagtacatcgcgatgctgaag
gaacgcgaaccgcagcagtgggtctttgacgaaatgaagaacctggccgaagtcgaattc
cgctttaagcaaaagtcccccgccagccgattcacaagtcgtctgagcagtgtcatgcag
aagcctatgcccagagagtggcttctaagtggatccctcctgcggaaattcgacccggag
ctcatcaagaaggctctggcgtgccttcaacccgacaatttcaggatgatcgttgtgtct
caggaacatccgggagattgggactccaaggagaagtggtatggaaccgagtacaaggtc
cagaagctaccgcaagacttcatggccgatatcaagaacgcattggccacgacgccagaa
acgagattgtctgaactccacatgcctcacgagaacgaattcgttccaacaaggctgtcg
gtcgaaaagaaagatatttcggaacctgccaagacgcccaagctgattcgtcacgatgaa
catgtgcgcctgtggttcaagaaagacgatcgcttctgggtgccgaaaggcacggtccac
attacgttgagaaacccgctggcgtgggctaccccggccaatctggtgaagtccaagctt
tattgtgagcttgtcaaggatgcgctagtagaatattcatatgatgccgaactggcgggg
cttgactaccatctctccgccagtgtattcgggttggatatctctgttggtggctacaac
gacaagatggccgttctcctggagaaagtgctgacgagcatgcgtgacttggtagtcaac
cctgaccggttccacattatcaaggaacgcttgtctcgaggatatcggaatgcagagtat
cagcagccgttctaccaggttggtgattacaccaggcacctcaccgctgaaaagacttgg
atcaatgaacaatacgctgctgagttggagcatattgagccggaagatatctcgaacttc
tttccccagctgcttcagcagaatcacgtcgaggtcctggcacacggcaacctttacaag
gaggatgcactgcgaatgaccgacctggtggagaatgttctgcaaagccgtcctttgccc
cagtcgcagtggcatgtgcggcgcaacatcatcatcccccctggaagcaattatgtctat
gaacgcacgcttcaagatcctgccaatgtcaaccactgcatcgagtattatgtttatgtg
ggaagcattcgagacgatatccttcgcgcgaagcttctgctgttcgcgcagatgacggac
gaacctgcattcgaccagcttcggagtaaggagcagctcggatatgtggtttggagcggc
gcgcgctactccgccaccactatcggttaccgagtgataatccagagtgagcgtacggcc
gagtatctggagtcgcgcatcgacaacttcctgattcaagccggggagaccttggagaat
atgtccgataaggactttgagggacacaagcggagtgtagtcaacaagagactggagaag
ctcaagaatctgagctctgaaacatcacgcttctggagtcacattggctccgaatacttt
gactttgtacagaacgagaccgacgcagccaacgtcaggaccctgaccaaggctgatatc
gtcgacttctacaagcagcttatcgacccccggtccccgactcgcggcaagctgtctatc
tacttgaacgcgcaggcaggtggacacacacatacaatcgaccccaaggaacagcgatcg
cagttggtgtcgctatttggcaagcagttagagactgccgggtttgcagttgacaccgaa
cgcttcggctcagtctttgagagcgtcgatgtgtctgccggcaacaccgagcagattctg
tcggtcctcaaggcattcttgacttccgaaatgagtctttccgagcaacaggttgcccct
gtcctggagcaagccaaacagaacattggacttcacgcgaagcagcttggcattgaagcc
gtcgaccaggactcgaagcccttgaccaacggcaccggtaaggcccaggataagcagaag
gtcacctacatcacaaatgtaccggacttcaaagccagcctgtcgatgagtgcggggcct
cttgcggccacggacctcactgagtttgaagactttgacgccaaactgtga

DBGET integrated database retrieval system