KEGG   Aspergillus clavatus: ACLA_004560Help
Entry
ACLA_004560       CDS       T01148                                 

Definition
(RefSeq) H /K ATPase alpha subunit, putative
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:act04147]
    ACLA_004560
Enzymes [BR:act01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     ACLA_004560
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACLA_004560
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_004560
  Exosomal proteins of colorectal cancer cells
   ACLA_004560
  Exosomal proteins of bladder cancer cells
   ACLA_004560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 DUF2157 DUF2231
Motif
Other DBs
NCBI-GeneID: 4708728
NCBI-ProteinID: XP_001276468
UniProt: A1C5S4
AA seq 1096 aa AA seqDB search
MDKAPKSAEEEIDRLRWQADDEETGNHARNTRPALTRTVSSASNSSHVSVHSHHRRTIVD
PSVSLPIHYRTVSFDIEEAKEREEREKATAQSGVAADLSNLDWHTISVEELQKRWQVDIS
QGLSPEQVQKRVREYGKNALSPLPHQWFWQVFGYFFKGFGAILLVGCILVFVSWKPLGQP
PALANLALAIVLLAVFFIQAAFNAWQDWSSSRVMASITAMLPESCLVMRGGSLAVVSAPD
IVPGDVVHLKAGNKLPADVRFVEVSNDAGFDRSILTGESLPINGTVDSTDVNYLETHSIG
LQGTHCVSGSVIGVVVSTGDSTVFGRIAKLTSEPKTGLTPLEKEILRFVTLIVVIMLVMI
IVIIIVWATWLRKDHPDWINVPTLIVDCVSVAIAFIPEGLPIALTANLTITANLMSKHKI
LCKSLKTVETLGSVSVICSDKTGTLTKNRMFVTDCAVSSATYTPDSARDEMVLKGKNSAI
HQLRSVAGLCNAAEFDAATMQLPIHERKVIGDATDQAILRFSEGLGLVSELRSLWKKTFE
LAFNSKNKFMIRTFSLVDATGLNLAMSPAEAAQFQRDDTLLMIKGAPDILIDRCTHIVGI
DGNVQQLDQHALNQLKQVKDQWSTEGKRVILLARKVFSAGQIHSLPFSHEFEAEVMNHAK
TGLVLVGMAGIVDPPRDEIPEVVQTLRRAGIKIFMVTGDFGLTAVAIARQCGIVSTDGPV
DDIQSLKRFPPVNDNFSEKVRSSAISLSGSELIALNEHQWEQLCQYQEIVFWRTTPEQKL
RIVREFQARDEIVGMTGDGVNDAPSLKAADIGIALGSGSDIAIEASDMVLLDSFSAIVAA
VQYGRVVFDNLKKTIIYLLPAGSWSEFWPVLTSVVFGLPQVLSSFLMIIICCFTDCAAAT
VLAYEAPEADVLLRPPRKPKQERLVNWKLIFQAYGVIGMLETVVSFAMAYWYLERNGIPF
SALWFKFGEVPADIDPDWYAARLNEASSVYFINLVVMQWFNLMAIRTRRLSIFSHPPAFN
KNTQNLLLFPAILFALVMAVFWLYIPPLQNVLDTTSVPVEHYFLPAAFGLGILGLDELRK
AGVRRWPQGILAKMAW
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcccccaaatctgccgaagaggagatcgatcgtctccgctggcaagcggac
gatgaggagacaggcaatcatgccaggaacactcgcccggcactgacccgcactgtatca
tctgcgtccaacagctcgcatgtctcagtccacagccatcaccggagaactatcgttgac
ccttccgtctccttgccgattcattatcgaacagtctcctttgatatcgaagaagccaaa
gagcgcgaggagagagaaaaggcaaccgctcaaagtggtgtcgcagctgatctatccaat
cttgactggcacacaatctcggtcgaggagttacagaagcgatggcaagtggacatctcg
caaggtctttcccctgaacaagtccagaaacgggtccgcgagtatggcaaaaacgccctg
tcgcctctgccgcaccaatggttctggcaggtgtttggatattttttcaaagggtttggt
gccatcttgctggttgggtgtatcctggtgtttgtttcctggaagcccctgggccaaccg
ccagcgctcgccaacctcgccctggctattgtgctcctcgctgtttttttcattcaagcg
gctttcaatgcatggcaggactggtcatcatcccgagtcatggcatccatcactgctatg
cttcccgaaagctgtctcgtcatgcgcggtggctccctggcagtagtgtcggctccagac
attgtgccaggtgacgtggtgcacctcaaggcaggaaacaaattgccggcggatgtccgt
tttgtagaagtttccaacgatgcgggattcgatcgatcgattctgactggcgaatcgctt
cccatcaatggtacggtggattcaacagacgtcaactatctggagacccatagcattggc
ctccagggtacacattgtgtctctggcagtgtgataggcgtggttgtctctacaggtgac
tcgaccgtctttgggcgtatcgcgaagctcaccagcgagcccaaaaccggcctaactccg
ctggagaaggagattctgcgcttcgtcactttgattgtagtcatcatgctggtcatgatc
atcgtcatcattattgtgtgggccacttggttacgaaaggaccatcccgactggatcaac
gtcccaaccttgatcgtggactgtgtcagcgttgccattgcgtttattccagaaggtcta
ccgatcgctctgactgccaacttgactattacggcgaatctcatgagcaagcacaagatt
ctctgcaaatcgctcaagacggtggaaacgttgggatcggtctcggtgatttgttcggac
aagactggcactttgacgaagaataggatgtttgtcaccgactgtgcggtgtccagcgcc
acctatacgcccgattccgccagagacgagatggttttaaaagggaaaaactctgccata
caccaacttcggtctgttgccggtttgtgcaatgcagccgaatttgatgctgccaccatg
cagctcccgatccacgagaggaaggtcattggcgatgcgaccgaccaagcgattctacgg
ttctctgagggactcggtctcgtctcggagcttcgtagtctctggaagaaaacattcgaa
ctggcatttaacagcaagaacaaattcatgatccgaacattcagcttggttgatgctacc
ggtctcaacctcgcaatgtcgccagccgaggcagcgcagttccagcgggatgatacacta
ctgatgatcaaaggcgctccggatattctgatcgacagatgcactcatattgtgggtatt
gacggcaacgtgcagcagctggaccagcacgcattgaaccaattgaagcaagtcaaggac
cagtggtccaccgagggcaagagagtcattctcctggcccgaaaggtcttctcggcgggg
caaattcatagcttacctttctctcacgagttcgaagcagaggtgatgaaccatgccaaa
actggtctcgtcctcgtcggtatggccggcattgttgatcctccaagagatgagattccc
gaagtagttcaaaccctacgacgggccggcataaagattttcatggtaactggcgatttt
ggcctcacagcggttgccattgcacggcaatgtggtatcgtgagcacagacggcccggtt
gacgacatccagtctctcaaaagattccctcccgtcaatgataacttcagcgaaaaggtt
cgctcatctgccattagtctgagtggtagtgaactcattgccctgaacgaacatcaatgg
gagcagctctgccaataccaggagatcgtgttttggcgaaccaccccggagcagaaactt
cgaattgttcgcgagtttcaggcgcgtgacgagattgtgggaatgaccggtgatggtgtg
aatgacgccccatccctcaaggctgcagatattggcattgctctgggaagcggatcggac
attgcaatcgaggcatccgacatggtccttctggactccttttcggccattgtcgcagcg
gtgcagtacggacgagtagtcttcgacaacctgaagaagacgattatctatcttctacca
gctgggtcctggtccgaattctggccggtgttgaccagtgtagtgtttggtcttcctcag
gtcctgtcctcgtttctgatgatcatcatctgctgcttcactgactgcgctgccgcgacc
gtcctggcatacgaggctccagaagccgatgtgcttctgcgccctcccagaaagcccaag
caagaacggctggtgaactggaaactgatattccaagcgtatggtgtcattggcatgctc
gaaaccgtggtttcgtttgccatggcttactggtatctggagcgaaatggtatccctttc
tcagccttgtggttcaagtttggcgaggtgcctgccgatattgatcccgactggtatgct
gcacgcctgaatgaggccagctcggtatacttcatcaacctcgtggtaatgcaatggttc
aatctgatggccattcggacccgtcggctgtccatcttctcgcatccgccggccttcaac
aaaaacacccagaacctgttacttttcccagccatcctgttcgctctggttatggcagtt
ttctggctgtatattccgccattgcaaaatgtgcttgataccacgagtgtgcctgtggag
cattatttcctccccgctgcgtttggtctgggaatcctgggtctggatgagctgcgcaaa
gccggagtgaggagatggcctcaaggcattttggccaagatggcttggtag

DBGET integrated database retrieval system