KEGG   Aspergillus clavatus: ACLA_013700Help
Entry
ACLA_013700       CDS       T01148                                 

Definition
(RefSeq) RNA helicase-like splicing factor (HRH1), putative
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
act  Aspergillus clavatus
Pathway
act03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:act00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ACLA_013700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:act03041]
    ACLA_013700
Enzymes [BR:act01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     ACLA_013700
Spliceosome [BR:act03041]
 Complex C
  Other components
   Step II factors
    ACLA_013700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD T2SSE AAA_30 AAA_19 AAA_16 DUF2075
Motif
Other DBs
NCBI-GeneID: 4706191
NCBI-ProteinID: XP_001274359
UniProt: A1CB15
AA seq 1231 aa AA seqDB search
MDDLQSLELFSLVSRITGELQNHLGVSDKTLAEFVIDQHLSCGSFAEFKGKLEDMGAEFP
QSLMESIDRLVLTMHPKYKAKKSETTNDTAEGNGDMDVLDALEKKARVFKGLAVPDKQQH
WDEEDHIRNRDVDESDTKAGAMDDTFAMLEGLAGKAQEEKGRSTRDERVSRKRSRSPDHN
EYSRGRRRDARYRSRSRSRSPYYSKRDNEVDEFGRSTSKYNSRDDELRSGRSERRRLHNR
DDDDDYFRKPPPVELDDQPILYKIYDGVVTGVKDFGAFVNLKGVKGKVDGLVHVSAMLEG
ARVNHPSDLVSRGQPVKVKVISIQGSRIGLSMKEVDQVTGLDLIPQKRIASGANLERLEG
VSGKDRYGNLSSEVPVIEDHDGKPMKSRKRLTSPERWEIKQLIASGAVSAADYPDIDEEY
HSTLTGEGAFEEEEDVDIEVRDEEPPFLAGQTKMSLELSPIRVVKAPDGSMNRAAMAGTN
LAKERRDLRQQEAQDKAAEQAAEVDLSAQWQDPMAGPDQRKFAVELRNAQQPKPDDAVPE
WKRVTMGKNQSFGKRTNMSIKQQRESLPVYKFREQLLDAVRDNQLLIVVGDTGSGKTTQV
TQYLAEAGYANNGIIGCTQPRRVAAMSVAKRVAEEVGCRLGAEVGYTIRFEDCTSPETKI
KYMTDGMLQREVLLDPDLKRYSVIMLDEAHERTIATDVLFGLLKKTIKRRPDLRLIVTSA
TLDAEKFSEYFNKCPIFSIPGRTYPVEVMYSKEPEPDYLDAALITVMQIHLTEPAGDILL
FLTGQEEIDTACEILYERMKALGSTVPELVVLPVYSALPSEMQSRIFEPAPPGGRKVVIA
TNIAETSITIDNIYYVIDPGFVKQNAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGK
CYRLYTEAAYQSEMLPTTIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTAL
EELYALSALDDEGLLTRLGRKMADFPMEPALAKVLIASVDMGCSEEMLSIVAMLSIQSVF
YRPKEKQQQADQKKAKFHDPHGDHLTLLNVYNGWKNSKFNNAWCFENFIQARQIRRAQDV
RQQLMGIMDRYHHKIVSCGRNTVKVRQALCTGFFRNAARKDPQEGYKTLVEGTPVYMHPS
SALFGKPAEHVIYHTLVLTTKEYMHCTTAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERI
QPLHNRFAGEDDWRLSAQRRQGRGGGGGTWG
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atggacgatctccagtccttagagcttttttcgctcgtgtcgcgaattacgggtgagctc
cagaatcacttaggcgtcagtgacaagacactcgctgagttcgtgattgaccagcatcta
tcatgtggttcgtttgccgaattcaagggcaagttggaggatatgggtgcggagttcccc
cagagtctgatggagagtatcgatcgcctggttcttaccatgcacccgaaatacaaagcg
aagaagtcagaaactacaaacgatacggcggaggggaatggggacatggatgtgctcgat
gctctcgagaagaaagcacgtgtcttcaaagggctcgccgttccagacaagcaacagcat
tgggatgaagaggatcacattcgaaaccgagatgttgatgagagcgacacgaaggctggt
gccatggacgacacatttgccatgttggagggactagcaggaaaggcccaggaagaaaag
ggtcgctctacgcgagacgagcgtgtcagcagaaagagaagcagaagcccagatcacaat
gagtacagccgtggtcgcaggcgcgacgccagatatcgctcccggtcccggtcgcgcagc
ccgtactacagcaagagagataacgaagtcgatgaattcggccgatcaacgagcaagtac
aattctcgggacgatgaacttcgtagcgggcgcagcgaacggaggcggctgcataaccgc
gacgacgatgacgactattttcgcaaacctcccccggtcgaactggacgatcaacctata
ctctacaagatctatgatggagtcgttaccggagtcaaagactttggcgcctttgtgaat
ctcaaaggggtgaaaggcaaagtggatggtttggtgcatgtctccgcaatgctagaaggg
gcacgagtcaaccatccctctgatttagtatcacgaggccaaccagtcaaggtcaaggtc
atcagcatacaaggctcgcgtattggcttatcgatgaaagaagtggatcaagtcactggc
cttgatcttattcctcaaaagcgcatcgcatcaggtgccaacttggagcgacttgaaggt
gtctctggaaaagatagatacggaaatttaagctcggaggtgccagtaatcgaggatcac
gacgggaagcccatgaagagccgtaaacgattgacctcgccggaaagatgggagataaaa
caactcattgcatctggtgcagtctcggccgctgactatcctgatattgacgaagagtac
cattccactttgactggcgagggtgcttttgaggaagaagaagatgttgatattgaagtt
cgcgacgaagaacctcctttcctggccggtcaaacgaagatgtctttggaactctcccct
atcagggttgtcaaggctcctgacggctccatgaaccgtgctgcgatggcaggtacgaat
ttagccaaggaacgaagagatttgagacagcaagaggctcaggataaggccgcagaacaa
gcggctgaggttgatctcagtgcacaatggcaagatcccatggcaggtccggatcagagg
aagtttgcagttgagttacggaacgctcaacaacctaaacccgacgatgcggtgcccgag
tggaagagagtcacaatgggcaaaaatcagtcgttcggcaagaggacaaacatgtcaatc
aaacaacagcgggagagcttgccagtttacaagtttcgcgaacagctgcttgacgctgtt
cgtgacaatcagctgttaattgttgttggagacactggatcagggaagactacccaggtc
acacagtatttggcggaggcaggatacgcgaacaatggcatcatcggttgcactcaacct
agacgtgtcgcagcaatgtcggttgccaaacgagtggcagaagaagttggttgccgactg
ggtgccgaggtcggatacacgattcgtttcgaggattgtaccagtcctgaaaccaagata
aaatacatgaccgacggtatgcttcagagagaggttctgctggatcctgatctgaagagg
tattccgtgatcatgctggatgaggctcacgagcggactatcgctactgatgtgctcttt
ggactcttgaagaagacaatcaagcgaaggcctgatcttcggctcatcgttacatcagcc
actttggatgccgagaagttctctgagtacttcaacaaatgccccattttttcgattccc
ggtcgtacttaccctgttgaggtcatgtattcgaaagagcctgaacctgattatctggac
gcggctctcattacagtgatgcagattcacctgacagagccggcaggcgatatccttctt
ttcttgacaggacaggaggagattgacacagcctgtgagattctatatgagcggatgaag
gctcttggctcaacagtacccgagctggttgttcttccagtttactctgccttgcccagc
gagatgcagagtaggatcttcgagcctgcaccaccaggtggtagaaaggtggttatcgca
acaaatattgctgagacttcgattacaattgataacatctactatgtcattgaccctggc
tttgtcaagcagaatgcttatgatcccaagcttggcatggactctctggtggtgacaccc
atttcccaggcacaggccaaacaacgagctggtcgtgcaggaagaactggcccaggaaag
tgctaccgtctgtacaccgaagcagcttaccagtcggaaatgctacccacgacaattcct
gaaattcagcgtcagaacctctcgcataccattctcatgctcaaggccatgggtatcaac
gacttgcttcatttcgacttcatggaccctcctcctacaaacaccatgcttactgcgttg
gaagagctctatgctctatctgcccttgatgatgaaggtcttttgacaaggttgggccgt
aaaatggcagacttcccgatggagccagctctagccaaggtcctcattgcatcagtggac
atgggttgctctgaggaaatgttgagtatcgtcgctatgctgtcgatccagtcggtattc
tatcgcccgaaggagaagcagcaacaggcagatcagaagaaagccaaatttcacgatccg
catggtgatcatttgactttgctcaatgtatacaacgggtggaagaactccaaattcaac
aacgcatggtgtttcgagaacttcatacaggcacgtcaaattcgtcgggcacaggatgtc
cgacaacaacttatgggtattatggaccgataccatcacaagatcgtctcatgcggaaga
aatacggtgaaggtacggcaagccctgtgtactggattcttcaggaacgcagcccgaaaa
gaccctcaggaaggctacaagactctggtcgaaggtacaccggtctacatgcatcctagt
tctgcgctatttggcaagccggcagagcatgtcatctatcataccctcgtgcttaccacg
aaggaatacatgcactgtactaccgccatcgagcctaaatggctagtcgaggccgcaccg
accttcttcaaagtggcgcccaccgatcgcctctcgaagcgcaagaaggcagagcgtatt
caaccactgcataatcgcttcgcgggagaagatgattggcgtctttccgcacaacgccgc
caaggaaggggtggtggtggaggtacatggggttaa

DBGET integrated database retrieval system