KEGG   Aspergillus clavatus: ACLA_015920Help
Entry
ACLA_015920       CDS       T01148                                 

Definition
(RefSeq) mitochondrial 3-hydroxyisobutyryl-CoA hydrolase, putative
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
act  Aspergillus clavatus
Pathway
act00280  Valine, leucine and isoleucine degradation
act00410  beta-Alanine metabolism
act00640  Propanoate metabolism
act01100  Metabolic pathways
act01200  Carbon metabolism
Module
act_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACLA_015920
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACLA_015920
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACLA_015920
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     ACLA_015920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 4706549
NCBI-ProteinID: XP_001274572
UniProt: A1CBM8
AA seq 470 aa AA seqDB search
MPLRAKVTNPAFGAAAKMSTAPELPKELPGDEPDDVLFNSLYGVRLIELNRPKKLNSLNG
SMARKILPRLKEWEKSQLANIVMLSGAGTKALCAGGDVAALALQNEKGPEGQQASADFFG
LEYRLDHVIATYTKPFISVMDGITMGGGVGLSVHAPFRIATERTVFAMPETTIGFFPDVG
GSFFLPRLDGEIGTYLALTSERLNGVQALYAGVATHYLHSSVLSNLTARLSELVFRDQAS
LPERLDLVNKTMAEFSIGLPSLEQEPIHLAGSLRSAIDRCFGHSTIEEIFKALEQETVQK
EWAQRTLETLSSRSPTSLKVTLRQMRVGKQWTISETFQREYQIAAQFMKHPDFVEGVKAR
LMSKPPRQATWQPATLGEVTNDAVDVFFKLPEGESRLSLFNKINYKQYPHAYGLPSEAEI
EKFVRDSSESANKTVSEFVQKWGHKEGVREKVAEVLARRTVQTPEGLRWE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccgcgccaaagtgacaaacccagcattcggggctgctgccaagatgtcgact
gcccccgaactccccaaggagctccctggagacgagcccgacgatgtcctcttcaattcc
ctctacggcgtgcggttgattgagctcaacagacccaagaagctgaactcgttgaacggc
tcgatggcacggaagatcctcccccggttgaaggaatgggagaaatctcaacttgcgaac
atcgtcatgctgtccggtgctggtacaaaagctctctgcgcaggaggtgacgttgctgct
ctggctctgcagaatgagaagggcccggaaggacaacaggcgtcggccgacttcttcggc
ctcgaataccgcctggaccacgttatcgctacgtacacaaagccgtttatctcggtgatg
gatggaatcaccatgggcggcggtgttggcctcagcgtgcacgcccccttccgcattgcg
accgagcgtactgtcttcgccatgcccgagacgaccatcggattcttcccggatgtcggc
ggctctttcttcctcccccgtctcgacggtgaaatcggaacctacttggccttgacctcg
gagcgtctgaatggcgtgcaagcactttacgctggtgtcgccacacattacctgcattcc
agtgttctcagcaacctgacagctcgtctgtcggagctggtcttccgggatcaggcatcg
cttcccgagcgcttggatctggtcaacaagaccatggccgagttttctatcggcctccca
tctctggagcaggagcccatccacctcgctggtagcctgcgcagcgccatcgatcgctgc
ttcggccacagcacgattgaggagatattcaaggctctcgagcaggaaacggtgcagaag
gagtgggcccagagaaccctggagactctgtccagccgctcgcccacctcgctgaaggtg
actctgcgccagatgcgcgtgggcaagcagtggaccatctccgagacgttccagcgggag
taccagattgcagcccagttcatgaagcatcccgatttcgtcgagggtgtcaaggcccgc
ctgatgtccaagcctcctcgtcaggctacatggcagcccgctaccctgggcgaagtcacc
aatgacgccgtcgatgtgttcttcaagcttcccgagggcgagtcccggctgtccctcttc
aacaagatcaactacaagcaatacccccacgcctatggtctccccagcgaggctgaaatt
gagaagtttgtccgagacagctcggaatccgccaacaagaccgtttcggagttcgtgcag
aaatggggtcacaaggagggagtccgggagaaggttgcggaggttctggctaggcgaaca
gtgcagactcctgaaggtctgcgatgggagtaa

DBGET integrated database retrieval system