KEGG   Aspergillus clavatus: ACLA_016820Help
Entry
ACLA_016820       CDS       T01148                                 

Definition
(RefSeq) alpha-galactosidase, putative
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
act  Aspergillus clavatus
Pathway
act00052  Galactose metabolism
act00561  Glycerolipid metabolism
act00600  Sphingolipid metabolism
act00603  Glycosphingolipid biosynthesis - globo and isoglobo series
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_016820
  Lipid metabolism
   00561 Glycerolipid metabolism
    ACLA_016820
   00600 Sphingolipid metabolism
    ACLA_016820
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    ACLA_016820
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ACLA_016820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Ricin_B_lectin RicinB_lectin_2 Melibiase
Motif
Other DBs
NCBI-GeneID: 4706882
NCBI-ProteinID: XP_001274662
UniProt: A1CBW8
AA seq 525 aa AA seqDB search
MHPSMTLLAILPPLVRASIGNPHLLPTPPMGFNNWARFMCNLNESLFLDTAAAMLDTGLH
AAGYTRLNLDDCWMASHRAPNGSLPWDPTKFPHSLPWLSAQLRSLGFSLGIYQDAGNVTC
GGYPGSYGFEELDAHTFAEWGVDYLKLDGCNVSPAGAVSLADEYRARYARWHSVLGAMPH
PLVFSESAPAYFVDPQNATAWYGVMDWVPAYGELARHSTDILVYEGEGSAWQSIMVNYRY
NTLLARYQRPGYFNDPDFLIADHPGLSLVEKRSHFALWASFGAPLIISADVPGLSKEVIA
VLTNADLIRVDQDALGLQATLASRSEHLDVLTRSLDGGDRLVTILNRGDGGLAVKVPVGW
MGLQRCAYQAKNLWDGEIQEIEEDIEVQLDSHATEVFRVSLPPDCPMVIPTGIVFNTASG
NCLTDGEALAFEPCRGQDLQVWQVEESGILRPLSRTSHCLTAIGDNVVVKPCTGRPGQRW
TYHITGNLQNQHTGACLTEGTGIDVCGFELDSQVFGLPSGVDIEA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcatccatctatgaccctcctcgcaattctcccacccctcgtccgcgcctccataggc
aacccccacctcctccccacgccccccatgggcttcaacaactgggcccgcttcatgtgc
aacctaaacgaatccctcttcctcgacaccgcagccgcaatgctcgacaccggcctccac
gccgcaggctacacccgcctcaacctcgacgactgctggatggcatcccaccgcgccccg
aacggctccctaccctgggacccgaccaagttcccccacagcctcccctggctctctgcg
cagctccgatccctcggcttcagcctcggcatctaccaggacgccggcaacgtcacctgc
ggcggataccccgggtcctacggattcgaggaactcgacgcccacacgttcgccgagtgg
ggggtcgattacctcaagctggacgggtgtaatgtctcccctgccggggccgtgtcgctg
gcggacgagtacagagcgcggtacgcccgctggcattctgtcctcggcgccatgccgcac
ccgctggtgttctcggagagcgcgcccgcgtactttgtcgacccgcagaacgccacggcg
tggtatggcgtcatggactgggtgccggcgtatggggagctggcgcgccattctacggat
atcctggtgtatgagggcgaggggagcgcatggcagagtatcatggtgaattaccgctat
aatacgctgttggcgaggtaccagcgtcctgggtattttaatgatccggatttcctgatt
gcggatcatccgggtctgagcctggtggagaaacggtcgcatttcgccttgtgggcgtcg
tttggggcgccgctgattatcagtgcggatgtgccggggttgtcgaaggaggtgattgcg
gttttgaccaacgcagacttgattcgggtggatcaggatgcactgggattgcaggcgacg
ctggcgagtcggagtgagcaccttgatgtactgacgaggagtttggatggtggggatcgg
ttggtgacgattttgaatcggggggatggcggtcttgccgtcaaggtgccggtggggtgg
atggggctgcagagatgtgcataccaggcgaagaatctctgggatggagaaatacaggaa
attgaggaggatatcgaagtacagctggactcgcatgctacggaggtgtttagggtgtct
cttccccccgattgtcccatggtgatccctacagggattgtgttcaacacagcgtcgggg
aactgtcttacggatggcgaggctctggcattcgagccgtgccggggacaagatttgcaa
gtctggcaggtggaagagtcggggattctgcgtccgctctcgcgaacctcccactgcttg
acagccataggagataatgtggtggtcaagccatgcacagggcgccccggccagagatgg
acataccatatcactggcaacctgcaaaatcagcataccggtgcttgtttgacagaaggt
acaggcatagatgtctgtggatttgagctggatagccaggtattcggtctgcccagtgga
gttgatattgaagcgtag

DBGET integrated database retrieval system