KEGG   Aspergillus clavatus: ACLA_021080Help
Entry
ACLA_021080       CDS       T01148                                 

Definition
(RefSeq) ABC transporter, putative
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane PDR_CDR ABC_tran ABC_trans_N RsgA_GTPase AAA_16 AAA_25 AAA_29 SMC_N ABC2_membrane_3 AAA_33 AAA_18 Ploopntkinase3 cobW
Motif
Other DBs
NCBI-GeneID: 4700958
NCBI-ProteinID: XP_001268826
UniProt: A1CP29
AA seq 1494 aa AA seqDB search
MSLLGTINPNLNPERTVAGQKGQEEEDSGRVQSNHHKLASSVSTDETILDHSKEVGNEEY
AEEEVTRLARQLTRQSTRFSVSGHVENPFLETKEDSTLNPHSPNFKAKNWMKNLLALSSR
DPERYPKRVAGVSFRNLSIHGYGSPTDYQKDVFNSVLQVGTLARNIMGTGKQKIQILRGF
DGLVKSGEMLVVLGRPGSGCSTMLKTIAGEMNGIYMDDKSQLNYQGISAKQMRKQFRGEA
IYTAETDVHFPQLSVGDTLKFAALARAPRNRLPGVSREQYATHMRDVVMAMLGLTHTVNT
RVGNDFVRGVSGGERKRVSIAEVTLSGSPLQCWDNSTRGLDSANALEFCKTLNLMTKYAG
ATVAVAIYQASQSAYDVFDKVTVLYEGRQIYFGRTDEARGFFTNMGFDCPERQTTADFLT
SLTSPSERLVKPGFEGKVPQTPDEFVQAWKNSEAYARLMREIDEYDREYPIGGESLDKFI
ESRRAMQAKNQRVKSPYTISVWQQVQLCMTRGFQRLKGDSSLTTSQLIGNFIMALIIGSV
FFNLRDDTSSFYARGALLFFAVLLNAFSSALEILTLYAQRPIVEKQSRYAMYHPFAEAIA
SMLCDMPYKILNAIIFNITLYFMTNLRREPGAFFVFLLFSFVTTMSMSMIFRTIAASSRT
LSQALVPAAILILGLVIYTGFTIPTRNMLGWSRWMNYIDPIAYGFESLMVNEFHNRRFLC
PDSGFVPSRGAYDSQALQYRICATVGARAGSKYVEGDDYLNQSFQYYQSHKWRNLGIMFG
FMFFFMMTYLLATEYISEAKSKGEVLLFRRGHASSAAPHDVETNAQVSTAAKTDDSSGKE
ATGAIQRQEAIFHWKDVCYDIKIKKEPRRILDHVDGWVKPGTCTALMGVSGAGKTTLLDV
LATRVTMGVVTGEMLVDGRPRDQSFQRKTGYVQQQDLHLHTTTVREALRFSAILRQPAHV
PRQEKLDYVEEVIKLLGMESYADAVVGVPGEGLNVEQRKRLTIGVELAAKPQLLLFLDEP
TSGLDSQTSWSILDLIDTLTKHGQAILCTIHQPSAMLFQRFDRLLFLAKGGKTVYFGEIG
EKSSTLASYFERNGAPKLSAEANPAEWMLEVIGAAPGSHSDIDWPAVWRDSPERKAVHDH
LEELKSTLSQKPIDASKADPGSYNEFAAPFAVQLWECLLRVFSQYWRTPVYIYSKAALCI
LTALYIGFSFFHAQNSAQGLQNQMFSIFMLMTIFGNLVQQIMPNFCTQRSLYEVRERPSK
TYSWKAFMTANIIVELPWNTLMAVLIFVCWYYPIGLYRNAEPTDSVHERGALMFLLVWTF
LLFTSTFAHMIIAGIELAETGGNLANLLFSLCLIFCGVLASPDALPGFWIFMYRLSPFTY
LVSGMLATGVSGTRAVCEKVELLHFDPPGNLSCAKYMADYISSRGGYLEIPDATSNCAFC
TISDTDTFLAAVSSYYKDAWRNFGIMWAYIIFNIFAAVFIYWLARVPKGKRTKE
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcttagggaccatcaatcctaatcttaatccagagcgtaccgtggctggccaa
aagggtcaggaagaagaagatagcggcagagtccagtccaaccatcacaagcttgctagc
agtgtgagcaccgatgagaccatcctggaccattcaaaggaggtcggcaatgaggaatac
gcagaggaagaggtcacccgtctggcgcgccaattaacccgtcaatcaaccagattctcc
gtcagtggccatgtcgagaatcccttcctcgagaccaaggaggattcgacgctgaacccc
cacagtcccaacttcaaggccaagaactggatgaagaacctgctcgcgctgtcatcacgg
gatccagagcgatatcccaagcgtgtggccggggtctcgttcagaaatctgagcatccac
ggctacggcagtcccaccgattaccagaaggatgtcttcaactccgtcctgcaggtcggc
accctggcccgcaacatcatgggcaccggcaagcagaagatccagattttgcgcggcttc
gacggtctcgtcaaaagcggagagatgctggtcgtcctcggtcgtcccggcagtggatgt
tcgaccatgctcaagactattgccggcgagatgaatggtatctacatggatgataagtcg
cagctgaactaccagggtatctccgccaagcagatgcgcaagcagttccgcggtgaggcc
atctacaccgccgaaaccgatgtgcatttcccacaactgtcggtgggtgatacgctgaaa
ttcgcggcgctcgctcgtgcgccacggaaccggctgccgggcgtctccagagaacagtac
gctacccatatgcgggatgtcgtgatggccatgctgggtttgacgcacacagtcaacacg
cgggtcggtaatgatttcgtgcgtggtgtcagtggtggtgagcggaagcgtgtcagtatc
gccgaagtgaccctcagcggcagtcctctgcagtgctgggacaacagtacccgtggattg
gacagtgcaaacgctctggaattctgcaagactctgaacttgatgaccaaatatgccggt
gctacggttgctgtggccatctaccaggcctctcagagtgcttacgatgtcttcgacaaa
gtgacggtgctctatgaaggacgacagatctactttggacgcaccgacgaggctagggga
ttcttcaccaacatgggatttgactgtcctgaacgtcagacaacagccgatttcctgaca
tccctcacaagcccttcggagcgcttggtgaagccgggctttgaaggcaaggtcccgcaa
actcccgatgaatttgtccaggcctggaagaatagcgaggcctatgccagactgatgaga
gaaatcgacgaatacgaccgcgaatatcccattggtggcgagtcgctcgataagttcatc
gagtctcgcagagcgatgcaggccaagaaccagcgcgtcaagtctccttacaccatttcc
gtctggcagcaggtccagctgtgcatgacccgtggcttccagcgtctaaagggtgactcc
agtttgaccacgtcccagctaatcggtaacttcatcatggctctgatcatcggaagtgtc
ttcttcaatctgcgggatgacacgtctagtttctatgctcgtggtgccctgctgttcttt
gccgtgctgctcaatgcattctccagtgctctcgagattctaacactgtacgcacaacgt
cccatcgtcgaaaaacaatcgcgttacgcaatgtaccaccccttcgccgaagccatcgcc
tcgatgctctgtgatatgccgtacaagatcctcaacgccatcatcttcaacatcaccctc
tatttcatgacaaaccttcgccgggaacctggggcgttcttcgtcttcttactcttttcg
tttgtcaccactatgagcatgtccatgatcttccgtaccatcgccgcatcgtctcggacc
ctctcccaggctctagtgcctgccgccatcctcatcttgggtctagtcatctacaccggc
tttacgatccccacaagaaacatgcttggctggtcgcgatggatgaactatatcgatccc
atcgcatacggattcgagagcttgatggtgaacgagttccacaacagacggttcctctgc
cccgactctggatttgtcccgtctcgtggtgcctatgatagccaagctctgcaatacagg
atttgtgcgacggtcggtgcccgcgccggctctaaatacgtcgagggcgacgactatctc
aaccagagcttccagtactatcaaagccacaagtggaggaatctgggcatcatgtttggt
ttcatgttctttttcatgatgacctatctgcttgccaccgaatacatctcggaagccaag
tccaagggtgaagtcttactgttccgcagagggcacgcttcctccgctgctccccacgat
gtcgagacaaacgctcaggtatccaccgccgcgaagaccgacgattccagcggcaaagag
gctaccggtgccatccagagacaagaggcgatcttccactggaaggatgtgtgttacgat
atcaagatcaagaaagagcctcggcggattctcgaccacgtggacggctgggtcaagcct
ggtacttgcactgctctcatgggtgtttccggcgccggtaaaactacccttctcgatgtg
cttgccacccgcgtgactatgggtgttgtgactggcgagatgttggtcgatggccgtcct
cgcgatcagtctttccagcgtaagaccggatatgtgcagcaacaggatcttcatcttcac
actaccaccgtcagggaggcactgcgcttcagtgctatcctccggcagcccgctcacgtc
ccccgccaggaaaagctcgactatgttgaagaagtcatcaaactgctcggcatggaatcc
tatgctgatgccgttgtcggtgtccccggagaaggtctcaacgtcgaacagcgcaagcgt
ctcaccatcggagttgaactcgccgccaagcctcaactgctcctctttcttgatgagcct
acctccggtcttgacagtcaaacctcttggtccattctcgatctcatcgacactctcacc
aagcacggccaagcgattctttgcaccattcatcagccctctgcgatgctcttccagcgt
ttcgatcgtctgttgttccttgccaagggtggtaagaccgtgtactttggagaaatcgga
gagaagtcgtcgacccttgccagttactttgagaggaatggtgcgccgaagctctctgcc
gaagccaaccccgccgaatggatgcttgaggtcattggcgccgcccccggatcgcatagc
gacatcgattggcctgcagtctggcgtgacagcccggaacgcaaagcggtgcatgaccac
ctggaagaattgaagtcgacgctctcgcagaagcccattgacgcctccaaggccgatccc
ggcagctacaacgagttcgccgctcccttcgccgtccagctgtgggagtgtctgctccgt
gtcttctctcagtactggcggacgcctgtgtacatctactccaaggccgcgctctgcatc
ctcaccgcgctctacatcggtttctccttcttccacgcgcaaaacagcgcgcagggcctg
cagaaccagatgttcagtatcttcatgctgatgaccatcttcgggaacttggtccagcag
atcatgcccaacttctgcacgcagcgctccctgtacgaggtccgcgagcgaccctccaag
acctactcctggaaggccttcatgactgccaacatcatcgtcgagctgccctggaacacc
ctcatggccgtcctcatcttcgtctgctggtactaccccattggcctgtaccgcaacgcc
gagcccaccgactccgtccacgagcgcggcgccctcatgttcctcctcgtctggaccttc
ctcctcttcacctccaccttcgcccacatgatcatcgccggcatcgagctcgccgaaacc
ggcggcaacctcgccaacctcctcttctctctctgcctcatcttctgcggtgtcctcgcc
tccccggacgccctcccgggcttctggatcttcatgtaccgcctctcccccttcacctac
ctcgtgtccggcatgctcgccaccggcgtctccggcacccgcgccgtctgcgagaaggtc
gagctcctccacttcgaccccccaggcaacctgtcctgcgcaaagtacatggccgactac
atctcctcccgcggcggctacctcgagattccagacgccacctccaactgcgcattctgc
accatctccgacacggataccttccttgccgccgtcagcagctactacaaggacgcctgg
cgcaacttcggcatcatgtgggcctacatcatcttcaatatctttgccgccgtcttcatc
tactggctggcgcgtgtgcccaagggcaagcgcaccaaggagtga

DBGET integrated database retrieval system