KEGG   Aspergillus clavatus: ACLA_023200Help
Entry
ACLA_023200       CDS       T01148                                 

Definition
(RefSeq) transcriptional elongation factor Iws1, putative
  KO
K17498  transcription factor SPN1
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:act03021]
    ACLA_023200
Transcription machinery [BR:act03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     ACLA_023200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 4701087
NCBI-ProteinID: XP_001269032
UniProt: A1CPN5
AA seq 450 aa AA seqDB search
MSASPESKPHSPAAAVSDHEPQVDLAEETARPPTPGADDNDDGQDEAAASATPAAQSAAG
DDDDEDEDDADAVDSDEESILSEVDEAQFDDFDPENVDVEDRPQLAIDEDNLKLIGRHKR
KRTEEDSERVQRKREGRREKKSRRLRDMEEGGDEGDSKARRRDRKKRDPTPEDEDLLDPA
TRRRRALDRAMDEAMKKPTKRRFRKADGIDLEQMADAEIEDMRKRMTHAAQLDAINRREG
RPAMHKLKMLPEVVSLLNRNQYVNSLVDPEINLLEAVKFFLEPLDDGSLPAYNIQRDLMT
ALGKLPINKEALIASGIGKVIVFYTKSKRPEAGIKRMAERLLAEWTRPILQRSDDYSKRV
YQEAEYDPRKVTARTTSAQASVAEARQRELLPPRLANRARAEITHTSYTIVPRPTMVQES
KFARPLGASGEDRFRRMRARQIAAAKGSRR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaagcccagagagcaagccccattcccccgccgccgccgtatcggatcatgaa
ccccaggtggacctggccgaggagacagccagaccgccgactcctggcgccgacgacaac
gacgacggacaagacgaggcagcggcatccgcaacgcccgcggcgcaatcggcggctggt
gatgacgatgatgaagacgaggacgacgcagacgcagtggattcggacgaggagtcgatt
ctctcggaagtcgacgaggcacagttcgatgactttgaccctgagaatgttgatgtcgag
gatcgcccacagctcgcgatcgacgaggataatctgaaactgatcggtcggcacaagcgc
aagaggacagaggaggatagcgagcgcgtccaacggaagcgggaagggcgccgggagaag
aagagtcgccggctacgggatatggaggaggggggcgacgagggcgattctaaggctcgt
cgcagggatcggaagaagagagatcctacgcctgaggatgaggacttgctggaccccgct
acacgtcgtcgcagagccctcgaccgcgcgatggacgaggcaatgaagaagcccaccaag
agacggttccggaaagccgatggaattgacttggagcaaatggccgatgctgagatcgaa
gatatgcgcaaacgcatgacacatgccgcccaactggacgcgatcaaccgccgcgaaggc
cgtcctgccatgcacaagctgaagatgctcccagaggtcgtctcactactgaatcgcaac
caatacgtgaacagtctggtcgaccctgaaatcaatctcctcgaggccgtcaagttcttc
ctcgaaccgctcgacgacggctcactgccggcttacaacattcagcgcgatctgatgacc
gcattgggcaagctccctatcaacaaggaggcactgatcgcgagcggaattggcaaggtg
attgtgttctacaccaagagcaaacgcccggaagctgggatcaagcggatggcggagcgt
ctgctcgccgaatggacgcgacctatcctgcagcgcagcgacgactactcgaagcgggtt
taccaggaagctgaatatgaccctaggaaagtcactgctcgtactacatctgctcaagcg
agtgttgcagaggctcgccagcgggaactccttcctccccgtctagccaaccgtgctcgg
gccgaaatcacccataccagctacaccattgttcctcgcccgacgatggtgcaagagagc
aaatttgcccgtccccttggagccagcggagaggatcgattccggagaatgcgggcgcgg
caaattgctgccgcgaaaggatcacgacgctag

DBGET integrated database retrieval system