KEGG   Aspergillus clavatus: ACLA_024960Help
Entry
ACLA_024960       CDS       T01148                                 

Definition
(RefSeq) glycerol-3-phosphate phosphatase (GppA), putative
  KO
K06116  glycerol-1-phosphatase [EC:3.1.3.21]
Organism
act  Aspergillus clavatus
Pathway
act00561  Glycerolipid metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ACLA_024960
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.21  glycerol-1-phosphatase
     ACLA_024960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 4701652
NCBI-ProteinID: XP_001269206
UniProt: A1CQ59
AA seq 231 aa AA seqDB search
MAQAQGSFSAPPQVVSFDGVLSDFDGTIIDSTDGEIGAELGVDPETILATSHGRRSIDTL
QLYDPIKANWEYVSYIEGRIPKEFGADAVEIPGARSLLDALENAGARWGVVTSGSRALID
GWLSVLKLTHPETLVVAEDVQQGKPDPSCYLLGRSKLNLEHSSSLVVLEDAPSGIRAGKA
AGFKVIALTTTHTLAQLQEAGADWIVEDLRSLSVKGVEGGKIQLEIKDAFQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagcacaaggatccttctcagcccctccgcaggtggtctctttcgatggcgtc
ttgtccgatttcgatgggacaatcatcgactcgaccgacggcgaaatcggtgccgagcta
ggcgtggaccccgagacaatccttgcgacatcccacggacgcagaagcatcgataccctc
cagctgtacgacccaatcaaggccaactgggaatatgtcagctacattgaaggccgtatc
cccaaggagttcggcgcggacgccgtcgagatccccggcgccaggtcgctcctcgacgcg
ctggagaacgccggcgcacgctggggcgtcgtcacctccggatcacgagcgttgattgat
ggctggctgagtgttctcaagctcacgcatcccgagaccctggtcgtcgccgaggacgtc
cagcagggcaagcctgatccgtcatgctacctgctgggccgctcgaagttgaacctcgag
cactcgtcgtcgctggttgtgctggaggatgcgccatcgggcatccgggcgggcaaggcg
gccgggttcaaggtgattgcgctgacgacgacccacacgctggcacagctgcaggaggcc
ggagcggattggattgtggaggacctgaggagtctctctgtcaagggcgtggagggcgga
aagatccagctggaaatcaaggatgcgttccaataa

DBGET integrated database retrieval system