KEGG   Aspergillus clavatus: ACLA_025560Help
Entry
ACLA_025560       CDS       T01148                                 

Definition
(RefSeq) glycosyl hydrolases family 6 protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
act  Aspergillus clavatus
Pathway
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACLA_025560
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     ACLA_025560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 4701939
NCBI-ProteinID: XP_001269265
UniProt: A1CQB8
AA seq 399 aa AA seqDB search
MRSLLTLTPLLFSAVRALPQATGTPTSSTGATSSPAPTASGGNPFEGYQMYTNPYYSSEV
ENLAIPSLTGSLVAQASAAAKVPSFLWLDTAAKVPSMGEYLEGIKAQNDAGASPPIAGIF
VVYDLPDRDCAALASNGEYLIADGGVEKYKAYIDSIRKHIDNYSDTQIILIIEPDSLANL
VTNLNVAKCANAADAYKECTNYALKTLDAPNVSMYLDAGHAGWLGWPANIGPAAKLFAGV
YKDAGSPKSVRGLATNVANYNAFIAKTCPSYTSQNEVCDEKSYINNFAPELASAGFDAHF
IVDTGRNGKQPTGQIEWGDWCNVVDTGFGVRPTTETGDELVDAFVWVKPGGESDGTSVTS
ATRYDAHCGLEDALKPAPEAGTWFQAYFEQLLKNANPTF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcggtctcttctcactcttacccccctgctgttctctgcagtgagggctctgcctcaa
gcaactggcactcccacctcgtcaactggcgccacgagctctcctgcccctaccgcgtct
ggtggtaatcctttcgagggttatcagatgtacaccaacccgtactactcgtccgaggtg
gaaaatcttgcgattccttccctgactggctctttggtcgcgcaggcaagcgctgcggcg
aaggtcccatccttcctctggcttgacacggccgctaaggtcccatcgatgggcgaatac
cttgagggcatcaaagcgcagaatgatgccggagccagccctccaattgccggtatcttc
gttgtttacgatcttcctgatcgcgactgcgccgccctggccagtaacggagagtatctc
attgccgacggcggtgtcgagaagtacaaggcatacattgattctatccgcaagcacatt
gacaactactcggacactcagatcatcctcatcattgagcctgacagtttggccaatctg
gtcacgaatctgaatgtggccaagtgtgccaatgccgcggatgcctacaaggagtgcacc
aactatgctctgaagactcttgatgctcccaacgtttcgatgtatctcgatgctggacac
gccggatggctgggatggcccgccaacatcggcccagcggccaaactattcgcaggcgtg
tacaaggatgccggctcgcccaagtctgtgcgtggtctcgcgaccaacgtggctaactat
aacgccttcattgccaagacatgcccgtcatatacttcgcaaaacgaggtttgcgacgag
aagagctacatcaacaacttcgctcctgagctggccagtgccggatttgacgcgcatttc
attgttgacaccggccgcaacggaaagcagccaaccggacagatcgaatggggtgactgg
tgcaacgttgttgacactggcttcggagtccgccctaccaccgagactggagatgagctg
gtagatgcttttgtctgggttaagcccggtggtgagagcgatggcacttcggtcacctct
gctacccgctacgatgcccactgtggtctcgaggacgccctgaaacctgccccggaggcc
ggaacctggttccaggcctacttcgagcagcttctcaagaatgctaaccccaccttctaa

DBGET integrated database retrieval system