KEGG   Aspergillus clavatus: ACLA_028880
Entry
ACLA_028880       CDS       T01148                                 

Definition
(RefSeq) c-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
act  Aspergillus clavatus
Pathway
act00100  Steroid biosynthesis
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
Module
act_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    ACLA_028880
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     ACLA_028880
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 4700988
NCBI-ProteinID: XP_001269588
UniProt: A1CR91
AA seq 498 aa
MASKKSDDKPKVPIQPVPEKRGYEFQGPIGAFGIIFGLPVLIYAFTFLCNDISGCPAPSL
LYPSTFSIDKLKQEVGWPQDGNRAFYDTRVTQWVLSYYLLSLFLQVFLPGTEVEGTELAC
GGRLKYKFNAFLSAALILSGCAVGTYLNGADFVVWTFLWDNYVQVITANLIICTVIAFFV
YVRSFSVPAPGQLNPELRQLAPGGHTGNALYDFFIGRELNPRIELPIPFVSKTARTIDIK
SWCEMRPGLLGWIILNLSNIAHQYRTHGYITDSIVFATVFQAFYVLDGLYMEPALLTTMD
IIMDGFGFMLSFGDLVWVPFLYNFQTRYLSVYPYELGLSGILIVLAVTAVGYSIFRGANN
QKNRFRTNPDDPRVKHIKYIKTATGSKLMTSGWWGCARHINYLGDWIMSWSYCLPTGIAG
YAIIESISPSSGEIHRQAVQTPEARGWGMVFTYFYMIYFGVLLIHRERRDEEKCKRKYGA
DWDRYTSLVRSRIIPGIY
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcgtcgaaaaagtctgatgacaagcccaaggttcccattcaacctgttccggagaag
cgtggctatgaatttcaggggcccattggagctttcggcatcatcttcggcctacctgtt
ctgatctacgccttcacgttcctctgtaacgatatctctggctgtcccgcgccatccctt
ctttatccctcgacattttcaattgataagctgaagcaggaggtgggctggccacaggat
gggaacagagcgttttacgacactcgagtcactcagtgggtgctgagctactaccttttg
agcttgttcctgcaagtgttcctccctggcaccgaagtcgagggaactgagcttgcctgt
ggaggacggcttaaatacaagttcaatgctttcctgtcggctgccttgatcctgtcggga
tgtgcagttggcacatatttgaacggtgcagacttcgtggtttggactttcctgtgggat
aactatgtgcaggtgatcacagcaaatctgataatctgcactgtcattgcattctttgtc
tacgtgaggagcttctcagttcccgctcctggtcagctgaaccccgagcttcggcaatta
gcccctgggggccacactggcaatgcattgtacgatttcttcatcggccgggagctcaac
ccccgcatcgagctgcccatcccgttcgtgagcaagacggcgcggaccattgacatcaag
tcgtggtgtgagatgaggcccggtctgctgggatggatcattctcaacctgtccaacatc
gctcatcagtaccgcacccacggctacatcaccgactcgattgtcttcgcgactgtgttc
caggcattctacgttctggatggcctttacatggagccggcccttttgacgacgatggac
atcatcatggatgggtttggtttcatgctttcctttggcgatttggtctgggttccattt
ctgtacaacttccagaccagatacctctccgtctatccctacgagctcggtctgagcgga
atcctcattgttctggccgtgactgcagtgggctactcgatcttccgcggcgccaacaac
cagaagaaccgcttccgcaccaaccccgacgacccccgtgtgaagcatatcaagtatatc
aaaacggccactggctccaagctaatgacgtccggctggtggggctgtgcgcgccacatc
aactaccttggcgattggatcatgtcttggtcttactgcctccctaccggtattgccggt
tatgctatcatcgagagcatcagcccgtcatctggagagattcataggcaggccgtgcaa
acacccgaggctcgcggctggggaatggtgttcacgtatttctacatgatttacttcggc
gtgttgctgattcaccgggaacgccgtgatgaagagaagtgcaagaggaagtacggcgcc
gactgggaccgttatacatcccttgtccgaagccggatcattccgggtatctactaa

DBGET integrated database retrieval system