KEGG   Aspergillus clavatus: ACLA_032210Help
Entry
ACLA_032210       CDS       T01148                                 

Definition
(RefSeq) PfkB family kinase, putative
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
act  Aspergillus clavatus
Pathway
act00051  Fructose and mannose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ACLA_032210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:act04147]
    ACLA_032210
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     ACLA_032210
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACLA_032210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 4701525
NCBI-ProteinID: XP_001269912
UniProt: A1CS65
AA seq 314 aa AA seqDB search
MSLIAVGACYVDTILTIPHYPGEDEKLRASHITRRRGGNCPNTLEVLQQLVAHSSSPSKI
SLHLVAVLPSKTSIASQQIVSAFEPGVRLDHCIYREDFSEPASSYIIKSQSSGSRTIVNY
NELPEMTIQEFEAIADQIGAQATWYHFEGRIPEVTLACICYLRQQYSSVRISVEVEKPAR
PGLQELAMEADVVFYSKSWAQGQGYAFAEECLQKQSNLTANATLLCCTWGQDGAVALDTV
SGNIIHSPAYTASDFKVVDSIGAGDTFNAGMLYTLLCREDWGLTKKLRFTNRLAGTKVGQ
EGFSNLDKVLDHFS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgattgcagtaggtgcatgctatgttgacacaatcttaacgatccctcactat
ccaggagaagatgagaaactgcgtgcctcacatattactcgtcgacggggaggaaattgc
ccaaatacactagaggtgctccagcaactggtagcacatagttcgtccccctcgaagatc
tccctgcatctggttgcagttcttccttcaaaaacgtccattgcctcgcagcagattgtt
tcagcattcgagcctggcgttcgattggatcattgtatttatcgtgaggatttcagtgag
ccagcgtcaagttacatcatcaaaagccagtcgtctgggagcaggacgattgtgaactac
aatgagctcccagaaatgacaattcaggagttcgaagccattgcagaccaaattggtgct
caagctacctggtatcacttcgagggccggattccagaagtaacactagcttgcatctgt
tatcttcgtcaacaatactcctccgttcgaatcagtgttgaagttgagaagcctgcacgc
ccaggcttacaagagctggctatggaggccgacgtggtcttctattcgaagagttgggct
cagggacaaggttatgcttttgctgaggaatgtctacagaagcaatcaaatttaacagcc
aacgcgacccttctttgttgtacatggggccaggatggtgctgttgctctagacacggta
tctggcaatatcatacacagtcccgcatacacagcctcagattttaaagttgtggactct
atcggtgccggcgacacattcaatgctggaatgttgtacacattgctttgtcgagaagat
tggggcctcacaaaaaaactacgcttcacgaatcgacttgcagggacgaaagtaggacag
gaaggtttctcgaaccttgataaagtgttagatcatttttcttga

DBGET integrated database retrieval system