KEGG   Aspergillus clavatus: ACLA_054190Help
Entry
ACLA_054190       CDS       T01148                                 

Definition
(RefSeq) aminopeptidase, putative
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:act01002]
    ACLA_054190
Enzymes [BR:act01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     ACLA_054190
Peptidases and inhibitors [BR:act01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   ACLA_054190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20
Motif
Other DBs
NCBI-GeneID: 4706960
NCBI-ProteinID: XP_001274798
UniProt: A1C948
AA seq 388 aa AA seqDB search
MRVLAAIALGATGLRGALAAVVPQEVLGTNPHIHHEQEKYLIELAPYQTRWVTEEEKWAL
KLDGVNFIDITEEHNTGFYPTLNSASYVKYPLKMQYADEVVALNKNLSTANMKANLEHFT
SFHTRYYKSQTGIESATWLASQVEKVITESGAANHGATVERFAHPWGQFSIIARIPGQTN
KTVVLGAHQDSINLFLPSILAAPGADDDGSGTVTILEALRGLLQSGSVAQGNATNTIEFH
WYSAEEGGMLGSQAVFSSYKKNRREVKAMLQQDMTGYTKGALDAGAKEAVGIMIDYVDQG
LTRFVKEIVTTYCSLGYVETKCGYACSDHTSASKYGYPAAMATESEMENTNRKIHTTDDQ
IKYLSFDHMLEHAKLTLGFAYELAFAPF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagagttcttgcagctattgcgctcggcgcaacgggcctcagaggcgctctggccgca
gtcgtccctcaagaagtactcgggaccaatcctcacatccaccacgaacaggaaaagtac
ttgattgaattggcgccttaccaaacacgatgggtgaccgaagaagaaaaatgggcattg
aaactggatggcgtgaatttcatcgacatcacagaagagcataacaccggattctaccca
actttgaacagtgccagctatgtcaaatatccgctgaagatgcagtatgccgacgaagtt
gttgcgctcaataagaacctatccacagcgaatatgaaagccaacctcgaacacttcacg
tcattccatactcgctattacaaatcgcaaacagggatcgaatcagcaacatggcttgcc
agtcaggttgagaaggtgatcacagaatcgggagctgccaatcatggtgcgactgtcgag
cgttttgctcatccatggggtcaattcagcatcattgcccggatccccgggcagacgaat
aagacagtggtgttgggtgcccatcaggacagcatcaacttattcctgccgtccattctg
gctgcccccggtgctgatgacgatggaagcggaactgtcactatccttgaagctttgcgt
ggcctgctgcagtcaggctccgtcgctcagggtaatgcaacaaacacgattgagttccac
tggtattctgccgaggaaggtggcatgttgggctcgcaggcagttttctcaagctacaag
aagaaccggcgcgaggtgaaggcgatgcttcagcaggatatgaccggctacaccaaagga
gcgctcgatgctggggccaaggaggctgtgggaatcatgattgattacgtcgatcaagga
ttgactcggttcgtgaaggaaattgttacgacgtactgctctctgggatacgttgagacc
aagtgcggctatgcctgctccgaccatacatcggcaagcaaatacggatatcctgcggcc
atggcaactgagtcggagatggaaaataccaacaggaaaatccataccacggatgaccag
atcaagtatctgagcttcgatcacatgctggaacatgcgaaactgactcttggtttcgcc
tacgagctggcttttgcgccgttctga

DBGET integrated database retrieval system