KEGG   Aspergillus clavatus: ACLA_069390Help
Entry
ACLA_069390       CDS       T01148                                 

Definition
(RefSeq) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
act  Aspergillus clavatus
Pathway
act00380  Tryptophan metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ACLA_069390
Enzymes [BR:act01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     ACLA_069390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 4707638
NCBI-ProteinID: XP_001275335
UniProt: A1C688
AA seq 486 aa AA seqDB search
MGSRLHTREIQNGPPLPYNDDIRAFSKEYAESLDAQDPLHRFRNEFVIPSKEDLKRTTLD
PNQEPEHSPTPSLYLCGNSLGLQPQSTRKYIEYYLRAWATKGVTGHFVQHDDQLLPPFVD
VDAAGARLMAPIVGAMESEVAVMGTLTTNLHILMASFYQPTQERYKIIIEGKAFPSDHYA
VESQIKHHNFDPKDGMVLIEPEDHTRPVLDTEHIIRTIDEHASSTAVILLSAIQYYTGQY
FDIKRITAHAQSKGILVGWDCAHAAGNVDLQLHDWNVDFAAWCTYKYLNSGPGGTAALFV
HERHGRVNLEQVNSESEPFRPRLSGWWGGDKKTRFLMDNNFIPQPGAAGFQLSNPSVLDM
NAVVASLELFKQASMAEIRKKSLHITGYLEHLLLNYPLDTPSEKKPFTIITPSNPAERGA
QLSVRLQPGLLDHVLETLEDNAVVIDERKPDVIRVAPAPLYNTYTDVWEFCRIFHEACQK
ALKARG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggctctcgtctacatactcgagagatccagaacggacccccgcttccatacaacgat
gatattagggcgtttagcaaggagtacgcagagtcactcgatgctcaagaccctttgcac
cggttccgcaacgagttcgtcattccctccaaggaagatctaaagaggacgacattggat
ccgaatcaggaacccgaacattctcccactccaagcttatatctctgtggaaactcactc
ggacttcaacctcaaagtacccgaaagtacattgaatattacctccgggcctgggcaacc
aaaggtgtaacgggccattttgtccaacatgacgaccaattgcttcccccatttgtcgac
gtcgatgctgctggagccaggctcatggcgccgattgtgggagcaatggaaagcgaagtc
gcagtcatgggcacattgacgaccaacctccatatcctcatggccagcttctatcagccc
acccaggaaaggtacaagattatcatcgagggcaaagccttccccagcgaccattatgcg
gttgaatcccaaatcaagcatcacaacttcgacccaaaggatggcatggtcctcatagag
ccagaagatcatacccgccccgtcctggataccgaacatataatccgaaccattgatgaa
catgcatcgagtacggcggttatactgttatctgcgatacagtactataccggacaatac
tttgacattaagaggataactgctcacgctcagtccaagggtatcctggttggctgggac
tgtgcccacgctgcaggcaatgtcgatttgcagctacatgactggaacgtcgacttcgcc
gcgtggtgcacttacaagtatctcaatagcggaccaggaggcacggccgctctctttgtg
catgaaagacatggccgggtgaatttggaacaggttaattccgaatcagagcctttccgt
ccacgcttgtcaggttggtggggaggagataagaagactcgtttcctcatggacaacaat
ttcataccccagccgggtgccgcgggatttcagctatcaaatccatcggtgctggacatg
aatgcagtagtggcatccttagagctgttcaaacaggcttcgatggctgagattcggaaa
aagtcactgcacatcacaggctacctagaacacctccttctcaactatccgctggacaca
ccctccgaaaagaagcccttcacaatcatcactccttccaatccagccgagcgcggtgcc
cagcttagtgttcgtctccaacctggcctcctcgaccacgttctggaaacgttggaggat
aatgcagtagtcatagacgagaggaagcctgacgtcattcgcgttgcaccagcacctctt
tacaacacgtatacggacgtctgggaattctgccgaattttccacgaggcttgtcaaaag
gcgctcaaggcgcgcgggtaa

DBGET integrated database retrieval system