KEGG   Aspergillus clavatus: ACLA_082050
Entry
ACLA_082050       CDS       T01148                                 

Definition
(RefSeq) OPT oligopeptide transporter, putative
Organism
act  Aspergillus clavatus
SSDB
Motif
Pfam: OPT Col_cuticle_N
Other DBs
NCBI-GeneID: 4700264
NCBI-ProteinID: XP_001267941
UniProt: A1CT78
AA seq 761 aa
MARFQTRADGNDVEECPDDLALRDDGAPKKPVTAEEAMEIAIGESSTVEYTVESDNSPYL
EVRANVPNTDDPTLPINTFRMWFLGVVFTLLGTGVNQFFSMRYPSVTITSLVAQLVSYPV
GSFFAKALPIMKVRLFGRWDLVINPDHHFNVKEHAVITIMSNLSFNQSWASTIIQAQRVY
LKMPTRVGYQILLALSMQMFGLGLAGLSYRYIIEPPQMIWPSTLANAALFQTLHSGANPI
ADGWRISRYRFFLYVLIGSFCWYWLPGYIFTGLSTFAFVCWAAPNNKVLNNLFGMTTGLG
YLPTTFDWSQIAYNTSPLVMPFWAQANVFAGWLCVYAVVAPILYYTNTWFTAYLPLTGSD
AYDKTGSFYNSSRILDESGTIDETKYREYSPIFLPVTFALSYGMGFAVLSCLISHVLLYQ
YIQRPKQEGHPCEAAVSLSRCSMVVVRDSDSYCGGDSNLDSICLAYRTTILGSIYNACSG
GCLCDSRRHRLRSGQPQQQCLDCVRRDYIGIRAKGETTCSSDLQGVLVLPFFSKRLLTAL
QFYAYTGLSQAMYYGADMKLVACILGTLTQNGVLIWMLGNVKDMCSSDQPDNFTCPQGRV
NYNSAVFWGARLYSIGQRYSGLLHMFWIGALLPVITYFIRKRFPKSRFLDAVHWPIFFAG
TGNLPPATGINYTTAFAVSLIFNKIIKGRRPHWWAKYNYVLSAALDSGVAVAAILIFFAL
VFPGVSLNWWGNTVNSGTVDAKGVPWKELSANETFGESNWS
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggctcgatttcagacacgagcagacggcaacgatgtggaagagtgtcctgatgattta
gcgttacgtgacgatggagcccccaagaagcctgttacggccgaggaggctatggaaatt
gctataggggaaagcagtacggtcgaatacactgttgaatcggacaattccccgtacctg
gaagtccgcgccaatgtgcctaacaccgatgaccctacactgcctatcaacacattcagg
atgtggttcttgggtgttgtctttactctgctcggcacaggagtcaaccaatttttctca
atgcgttatcccagtgtgaccatcacctcgcttgtagcacagttggtcagttatcccgtg
ggatccttctttgcaaaggcgttgcctatcatgaaggttcggctcttcggacggtgggat
ctggtcatcaatcccgaccatcacttcaatgtgaaggagcacgctgtgatcactatcatg
tcaaatctcagcttcaatcagtcatgggcaagtacaatcatccaggcccagagggtgtat
ttgaagatgccaactcgagttggttaccagatcttgctggccctgtctatgcagatgttt
ggtcttgggctggctggattgtcttatcgatatatcatcgaacctccgcaaatgatctgg
ccgtccaccttggccaatgctgcgttgttccaaacacttcatagcggcgcaaatcctatt
gccgatgggtggagaatctctcgatacaggttcttcttgtatgtcttgataggcagcttc
tgttggtactggttacctggctacatttttactggcctgagcacgtttgcttttgtctgc
tgggccgctcctaacaacaaagtgctcaacaacctatttggtatgacgacgggtcttgga
tatctaccaacgaccttcgactggagccaaatcgcctacaatacgtcgccgctggtcatg
ccgttctgggcacaagccaacgtcttcgccgggtggctttgcgtttatgctgtggtggcc
ccaattctatactacaccaacacttggttcaccgcgtaccttcctctgactggctctgac
gcctacgacaaaactggaagtttctacaactccagtcgtatcttagacgagagcggcaca
atcgacgagacgaagtatcgcgagtatagtcctatattcctgcctgtcacttttgccctc
agctatggaatgggctttgcggtcctgagctgccttatcagtcacgtcctgctgtatcag
tacattcagaggccaaaacaagaaggacatccatgcgaggctgctgtctcactatccaga
tgttccatggtggtggtacgggattctgacagttattgtggtggcgatagcaatcttgac
tcaatatgtctggcatacaggactaccattttggggtctatttataacgcttgctctggc
ggctgtttatgtgattcccgtcggcaccgtttacgcagtggccaacctcaacagcaatgt
cttgactgtgttaggagagattatatcgggatacgtgctaaaggggaaaccacttgttct
tctgatcttcaaggtgtgctagtacttccgttcttttccaaaagattactcacggctttg
cagttttacgcatacaccggcttgagtcaagcgatgtattacggtgcagacatgaagctt
gtagcctgtattcttggaacattgacgcaaaacggtgttctcatatggatgcttgggaat
gtgaaggatatgtgctcaagtgatcaaccagataacttcacttgcccacagggccgggtc
aattacaacagtgctgtcttctggggtgcgaggctctatagtattggccaaagatattcc
ggtctactgcacatgttttggattggagccttactcccagtcatcacatacttcattcgg
aagaggtttcctaaatcgcggtttctcgacgcagtgcactggcctatcttctttgcaggc
accggaaacctaccaccagcgaccgggatcaattacacaactgcgtttgcagtcagcttg
atatttaacaagattatcaaaggccgcagaccacattggtgggccaagtacaactatgtg
ttatcagctgccctggactcaggcgtcgccgttgctgccattctgatcttctttgctttg
gtatttcctggcgtcagcttgaactggtggggaaacaccgtaaatagtgggacggttgac
gccaagggagtgccgtggaaagagctaagtgcaaacgagacgttcggcgagagcaattgg
tcatga

DBGET integrated database retrieval system