KEGG   Aspergillus clavatus: ACLA_084490Help
Entry
ACLA_084490       CDS       T01148                                 

Definition
(RefSeq) HAD superfamily hydrolase, putative
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:act01009]
    ACLA_084490
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     ACLA_084490
Protein phosphatases and associated proteins [BR:act01009]
 HAD phosphatases
  Other HAD phosphatases
   ACLA_084490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase NT5C Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 4700549
NCBI-ProteinID: XP_001268180
UniProt: A1CTW7
AA seq 292 aa AA seqDB search
MTKSTSSFPRVRACLFDMDGLLIDSEDKYTEITNSILQEFGKPLLPWEIKAQLQGRPQPE
ASKIFHHWAQLPIGPEEYAAKQAALQAKYFPQSQPLPGVASLLSNLVSTQTTDKPVYIAL
ATSSHSKNFKLKTDHLQDLFRAFPEPQRVLGDDPRIGKGRGKPLPDIYLLALETINESLR
QRGEPEITPEECLVFEDAVPGVEAGRRAGMRVVWCPHPGLLDAYKGREAEVLAGLTGEHK
EEEKSAPEREAEELTAWRIQGAGRPGQIDDGWADLLATLENFPYERYGIDLA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatccacttccagtttcccccgcgtgcgggcatgtctctttgacatggatgga
ctcctcattgactcagaggataaatacaccgagatcaccaattctattcttcaggaattt
ggaaagccattgctaccttgggagatcaaggcccagctccaaggtcgtccacagcctgag
gcaagcaagatcttccaccactgggcccaactccccatcggccctgaagaatacgcagca
aagcaggccgctctccaggccaaatacttcccccaatcgcaacctctgccaggcgtcgca
tctcttctctccaacctcgtctcaacacagacgacggacaagccagtctacatcgcccta
gccacatcctcacacagcaagaacttcaaactgaaaacggaccatctgcaggatctcttc
cgcgcatttcccgaaccccagcgggtcctgggcgacgatccgcggatcggaaagggacga
ggaaagccgctaccggatatttacttgctggctctagaaacgatcaatgagtccttgcgc
cagcgcggagagccggagatcacgcctgaagaatgccttgtctttgaggacgctgtgcct
ggcgtagaagccggtcgcagggcgggtatgcgggtggtctggtgcccccatcccggtcta
ttggacgcttacaagggacgggaagcggaggttctggctggcttgacgggcgagcataaa
gaagaagaaaagtcggccccggagagagaagctgaggagctgacggcgtggaggatccag
ggagcgggccggccaggccagattgacgatggttgggccgatttgcttgcgactttggag
aactttccctatgagagatatggaattgatctcgcatga

DBGET integrated database retrieval system