KEGG   Aspergillus clavatus: ACLA_085090Help
Entry
ACLA_085090       CDS       T01148                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00053  Ascorbate and aldarate metabolism
act00071  Fatty acid degradation
act00280  Valine, leucine and isoleucine degradation
act00310  Lysine degradation
act00330  Arginine and proline metabolism
act00340  Histidine metabolism
act00380  Tryptophan metabolism
act00410  beta-Alanine metabolism
act00561  Glycerolipid metabolism
act00620  Pyruvate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_085090
   00053 Ascorbate and aldarate metabolism
    ACLA_085090
   00620 Pyruvate metabolism
    ACLA_085090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACLA_085090
   00561 Glycerolipid metabolism
    ACLA_085090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACLA_085090
   00310 Lysine degradation
    ACLA_085090
   00330 Arginine and proline metabolism
    ACLA_085090
   00340 Histidine metabolism
    ACLA_085090
   00380 Tryptophan metabolism
    ACLA_085090
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACLA_085090
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ACLA_085090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 4699985
NCBI-ProteinID: XP_001268240
UniProt: A1CU27
AA seq 497 aa AA seqDB search
MSDLFTTIETPELKYEQPLGLFINNEFVKGVEDKTFETINPHNEKPIVAVQEATEKDVDI
AVAAARKAFEGEWRQVTPSDRGRMLTKLADLMERDMDTLCAIEALDNGKAFSMAKVDVIN
AAGCLRYYGGWADKIHGQTIDTNQETLTYTRHEPVGVCGQIIPWNFPILMWAWKIGPAVA
AGNVVVIKTAEQTPLSALYAAKLVKEAGFPPGVINVISGFGRVAGAAISSHMDVDKIAFT
GSTLVGRTILQAAAKSNLKKVTLELGGKSPNIVFEDADIDNAISWCWFGIYFNHGQCCCA
GSRILVQESIYDKFLARFKERTEQSKVGDPFHPETFQGPQISQLQFDRIMGYIEEGKKAG
AQVLTGGIRHGEEGYYIKPTVFADVKEDMKIVQEEIFGPVCTVQKFKDEEEAIKIGNSTT
YGLAAAVHTKNLNTAVRVSNSLKAGTVWVNNYNMISYQAPFGGFKESGLGRELGSYALEN
YTQVKTVHIRLGDAIFA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccttttcaccaccatcgagacccctgagctcaagtatgagcagcctttgggc
ttgttcatcaacaacgagttcgtcaaaggtgtcgaggacaagactttcgagaccatcaat
cctcacaacgagaagcccattgttgccgtgcaggaggctaccgagaaggatgtcgacatc
gctgttgctgccgctcgcaaggcttttgagggcgaatggcgccaagtgaccccctcggac
cgtggccgcatgctcaccaagctggctgatctcatggagcgcgatatggacactctgtgc
gccatcgaggctcttgacaacggtaaggccttcagcatggccaaggttgatgtcatcaac
gccgccggctgcctgcgctactacggtggctgggctgacaagatccacggtcagaccatc
gacaccaaccaggagactctcacctatactcgccacgagcccgtcggtgtctgcggtcag
atcattccctggaacttccccattctgatgtgggcctggaagattggtcccgcggtggcc
gccggtaacgttgtggtcatcaagactgctgagcagacccctctgtcggcgctctatgcc
gctaagctggtgaaggaagctggcttccctcccggtgtgatcaacgtcatctctggcttc
ggtcgtgttgctggtgccgccatctccagccacatggatgttgataagattgccttcact
ggttcgaccctggttggccgcaccattctccaggctgctgccaagagcaacctcaagaag
gtgactctcgaactcggtggcaagtcccccaacattgtcttcgaggatgccgacattgac
aacgccatctcctggtgttggttcggtatctacttcaaccacggccaatgctgctgcgcc
ggttccagaatcctggttcaggagtccatctacgacaagttcctggcccgcttcaaggag
cgcaccgagcagagcaaggttggagaccccttccaccccgagacattccagggcccccaa
atctcgcagctgcagttcgaccgcattatgggttacatcgaggagggcaagaaggccggt
gcccaggtcctcactggcggtatccgtcacggcgaggagggttactacatcaagcccact
gtgttcgcggacgtcaaggaggacatgaagatcgtccaggaggaaatcttcggccctgtc
tgcactgtccagaagttcaaggatgaggaggaggccatcaagatcggcaacagcaccact
tacggtcttgccgctgccgtccacaccaagaacctcaacaccgccgtccgtgtctccaac
tccctgaaggctggtaccgtctgggtcaacaactacaacatgatctcgtaccaggctccc
ttcggtggctttaaggagtccggcctcggccgcgagcttggctcgtacgctctcgagaac
tacacccaggtcaagacggtgcacatccgcctgggtgacgcgatcttcgcttaa

DBGET integrated database retrieval system