KEGG   Aspergillus clavatus: ACLA_085360Help
Entry
ACLA_085360       CDS       T01148                                 

Definition
(RefSeq) FKBP-type peptidyl-prolyl isomerase, putative
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
act  Aspergillus clavatus
Brite
KEGG Orthology (KO) [BR:act00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:act03110]
    ACLA_085360
Enzymes [BR:act01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ACLA_085360
Chaperones and folding catalysts [BR:act03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    ACLA_085360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 4700419
NCBI-ProteinID: XP_001268267
UniProt: A1CU54
AA seq 112 aa AA seqDB search
MGVTKEIKAAGNGADFPKKGDFVTIHYTGTLANGDKFDSSVDRGSPFQCQIGTGRVIKGW
DEGVPQMSLGEKAVLTITPDYGYGASGFPPVIPGNSTLIFEVQLLGINNKRA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaccaaggaaatcaaggccgccggcaacggtgccgacttccccaagaagggt
gatttcgtcaccatccactacaccggtaccctcgccaacggcgataagttcgacagctct
gtcgaccggggtagccccttccagtgccagatcggtactggccgtgtcatcaagggctgg
gatgagggtgttccccagatgagcctgggcgagaaggctgttctgaccatcactcctgac
tacggttacggtgctagcggcttccctcccgtcatccccggcaactccaccctcatcttt
gaggtccagctcctcggtatcaacaacaagagggcttag

DBGET integrated database retrieval system