KEGG   Aspergillus clavatus: ACLA_089170Help
Entry
ACLA_089170       CDS       T01148                                 

Definition
(RefSeq) histone acetyltransferase (Esa1), putative
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACLA_089170
Chromosome and associated proteins [BR:act03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    ACLA_089170
   HAT complexes
    TIP60 complex
     ACLA_089170
    NuA4 complex
     ACLA_089170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Acetyltransf_7 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 4705311
NCBI-ProteinID: XP_001272651
UniProt: A1CEC6
AA seq 508 aa AA seqDB search
MGVRDSHGEISGTPDPVEKGFATLNTIRIGVKAMVHKDGELRKAEILSIRQRKDGPSFYV
HYVDFNKRLDEWIDAARLDLAHEVEWPQPEKPEKKKAGAGNKAPSKNKRARGDSRDVSAT
PDLLTGKNVNVGKVQRPSKAGGKENRDGTPVAMPIVSADAVSVDGTPKAEADDVEMIDVS
FSEGKAIKEEEKALGLMSREEEIERLRTSGSMTQNPTEIHRVRNLNRLQMGKYDVEPWYF
SPYPASFSDVDIIYIDEFCLSYFDDKRAFERHRAKCTLVHPPGNEIYRDDYISFFEVDGR
RQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMCTRDETGCHLVGYFSKEKDSAEGYNL
ACILTLPQYQRRGFGRLLISFSYELSKREGKLGSPEKPLSDLGLLGYRQYWRETLVNILM
EPEREAISENELALLTSMTEKDVHETLVVFNMLRYHKGNWVIVLTDYVVEQHNKRLEKEK
VKGARKIDPARLQWKPPVFTASSRTWNW
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgcgagattctcacggggagatcagtgggacacccgaccctgtcgagaagggc
tttgccaccctcaacaccatccggatcggtgtcaaggctatggttcacaaggatggcgaa
ttgagaaaagccgaaattctgtctatcagacagcgcaaggatgggcctagcttctatgtt
cactatgtggatttcaacaagcgtctagacgaatggattgatgctgctcgactcgacctg
gctcatgaagttgagtggcctcagcccgagaagcccgagaagaagaaggccggtgctggc
aacaaagcacccagcaaaaacaagcgtgctagaggggacagccgcgatgtctctgccact
ccagatttgctcacgggcaagaatgtgaatgtcggcaaggtgcagcgtccgtccaaagct
ggcggaaaggagaatcgtgatgggactcctgtggctatgcccattgtgagcgcagacgct
gtctctgtggatggaaccccaaaggctgaagcagatgatgttgagatgatcgatgtcagc
ttctcggaagggaaggctatcaaggaggaggagaaagcgttagggctcatgtcgcgcgaa
gaggagatcgaacgactgcggacaagtggtagtatgacccagaacccgacggaaatccat
cgtgtgcgaaacttgaaccgtctgcaaatgggaaaatatgacgttgaaccctggtacttc
tcgccctatcctgcctcgttctctgacgtcgacatcatctacatcgacgagttctgtctg
agctacttcgacgacaagcgcgcgttcgagcgtcaccgtgcgaagtgcacgcttgtccat
ccgcctggtaacgaaatttaccgggatgactacatctctttcttcgaggttgacggtcgt
cgtcaacgcacttggtgccgtaacctctgtcttcttagcaagcttttcctcgaccacaaa
accctctactacgacgtcgaccctttccttttctactgcatgtgcacaagagacgagacc
ggctgccacctcgtcggatacttttctaaggaaaaagattccgcggaaggctataacttg
gcttgtatcctgacactaccgcagtatcaacggcgcggattcggtcggctgctcatctcc
ttcagttatgagctgagcaagcgcgagggaaagctcggttctcctgagaagccacttagt
gatcttggtctgctgggttaccgacaatactggcgggagacgctcgttaacatactcatg
gagcctgaacgagaagccatcagcgaaaatgaacttgctctcctgacctcgatgactgaa
aaagatgtccatgagacgctagttgtcttcaacatgctccgataccataaaggaaactgg
gtcatcgtcctgaccgactatgtagtagaacagcacaacaagcgcctggaaaaggagaag
gttaagggagcgcgcaagatcgatccagcacgtctgcagtggaaaccccccgtgttcacc
gcgtccagccggacatggaactggtga

DBGET integrated database retrieval system