KEGG   Aspergillus clavatus: ACLA_094550Help
Entry
ACLA_094550       CDS       T01148                                 

Definition
(RefSeq) beta-fructofuranosidase, putative
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
act  Aspergillus clavatus
Pathway
act00052  Galactose metabolism
act00500  Starch and sucrose metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_094550
   00500 Starch and sucrose metabolism
    ACLA_094550
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ACLA_094550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 4704744
NCBI-ProteinID: XP_001273181
UniProt: A1CFV6
AA seq 513 aa AA seqDB search
MRTHLLLISALVVAAQAVTYSGDLRPQVHFSPPANFMNDPNGLFYDSKREIYHLYYQYNP
YQTVAGNQHWGHATSPDLYHWTNHPIAISPSRSDEYIFSGSAVVDSNNTSGFFPGQDDGV
VAIYTLATAELQAQHIAYSTDGGYTFTKYEGNPVLDIGSSQFRDPQVVWHSETERWVMTI
AYADDRVIGFFTSPDLKEWTHASNFTQTGLPGTQFECPNLVRFSVGPVLPQENTKDVLFI
SVNPGAPLGGSGTFYVVGTFNGTHFVSETAHETLYDFGKDNYASQWYSGISEDEPPVSIG
WASNWNYTEQVPTGPLEGWRGAMTLPKVHTLTKVDGSWLVTQQPFDDLSSVRDKRLRAHV
AQNGDVTLDFKHVPSHAIYFDVRVDGISQSTSAGQVFFNFTSSKSGEYIDGGLNFNTGLF
WIDRAGTHLFTQANSSGYWPVFNTTLTAFEQSRFLFSGVIDRSLLEVFLDDGKQTGTMSF
YPASPLDTLTVFGRDLGEKIRFHVEAWGLESGW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcggactcatttgctgctcatctctgcccttgtggtagcagcccaggcagtgacttac
tctggagacctgcggccccaggtccacttctcccctccggcgaatttcatgaatgatccc
aacggacttttctacgacagcaagagagagatctatcatctttattatcaatataatccc
taccagactgtcgcgggtaatcagcactggggccatgccaccagcccagatctttatcac
tggactaaccatcccattgctatttcccccagcaggtcggatgagtatatcttctctggg
tccgctgtggtggacagcaataacacctcaggcttcttcccgggccaagatgacggtgta
gtggccatctacactctggcgactgcggaattacaagcgcaacacatcgcctactccacc
gatggcggatacacgttcaccaagtatgagggcaatcctgtgcttgatattggatccagt
caattccgcgaccctcaagttgtgtggcactcggagacggagcgctgggtcatgactatc
gcgtacgcagacgaccgtgtcattggatttttcacgtcgcctgatctcaaggaatggact
catgcttccaacttcacgcagactggattgccggggacgcagtttgaatgccccaacctg
gtcaggttctctgtgggtcctgtcctaccccaggagaacactaaggatgtgcttttcatc
tctgtcaatcccggcgcaccgctcggcggctcagggacgttttatgtcgtcggcacattc
aacggaactcattttgtctctgagactgcccatgaaacactctatgacttcggcaaagac
aactatgcctctcagtggtactcggggatttctgaggacgagcctcctgtctctattggg
tgggctagcaattggaattatactgaacaagtccccacaggcccgctcgaaggctggaga
ggcgcaatgaccctacccaaagtgcatactttgactaaagtcgacggatcctggctcgtc
actcagcaaccattcgacgacctgtcctccgtccgggataagcggttgagagcacatgtc
gctcagaatggcgatgtcaccctggacttcaaacatgtcccctcccatgcaatttacttc
gatgtgagggtcgatggcatctcgcaatccacatcggccggacaggtattcttcaacttc
acctcgtccaaatctggcgaatacatcgacggtggtctcaacttcaacacgggcctgttt
tggatcgatcgggcaggtacccatctcttcactcaggcaaatagctcagggtattggcca
gtcttcaacacgacccttacggcgttcgagcagagcaggtttttattctctggtgtcatc
gaccgctcacttctcgaggtattcctggatgacggaaagcagaccggcacgatgagtttc
tatccggcctcaccgctggatactctgacggttttcggcagggatttgggcgagaagatc
cggtttcatgttgaagcgtggggtttggagagcgggtggtga

DBGET integrated database retrieval system