KEGG   Aspergillus clavatus: ACLA_097020Help
Entry
ACLA_097020       CDS       T01148                                 

Definition
(RefSeq) malate synthase AcuE
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
act  Aspergillus clavatus
Pathway
act00620  Pyruvate metabolism
act00630  Glyoxylate and dicarboxylate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01200  Carbon metabolism
Module
act_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACLA_097020
   00630 Glyoxylate and dicarboxylate metabolism
    ACLA_097020
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ACLA_097020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 4702160
NCBI-ProteinID: XP_001270193
UniProt: A1CMI0
AA seq 539 aa AA seqDB search
MSQIEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNSTRKVLLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRNLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHLEARLWNDAFNLAQDYIGM
PRGTIRGTVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDSYVKLLIKTCHRRGVHAMGGMAAQIPIKDNAAANDKAMENVRADKLREV
RAGHDGTWVAHPALASIASDVFNKYMPTPNQLFVRREDVSITANDLLNTNVPGKITEDGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVYHQVTTSEGKKIDKAY
ALRLLQEQADSLAAKGPKGNKFQLAARYFAGQITGEAYADFLTSLLYNEISTPGTASKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcgaggtacagctcaaggatgtcgccatcctgggcgccgtgaacaacgag
caccgcaagatcctcaccaaggaagcctgcgctttcctcgccatcctccaccgcaccttc
aactccacccgcaaagtcctgctccagcgccggatcgaccgccaggccgagatcgataag
ggccatctgcccgatttccttcccgagaccaagcacattcgcgagaatgacgcctggaag
ggtgctcctcctgcccccggtctcgttgaccgtcgcgtggagatcactggtcccacggac
cgcaagatggttgtgaacgcgttgaatgcggatgtctggacttacatggctgatttcgag
gattcgagcgcccccacctgggagaacatgatcaacggccaggtcaacctgtacgatgcc
atccgccgccagatcgacttcaagcaaggaaacaaggagtacaaactccgcaccgaccgc
aacctccccaccctgattgctcgtgctcgcggctggcatctggatgagaagcacttcacc
gtcgatggcgagcccatctccggctctctgttcgactttggtctctacttcttccacaac
gccaaggagctcgtcgcccgcggccacggcccttacttctacctgcccaagatggagtct
cacctcgaggctagactctggaacgatgcctttaacctcgctcaggactacattggcatg
ccccgcggcaccatccgtggtaccgtcctgattgagaccatcaccgccgccttcgagatg
gacgagatcatctacgagctgcgggaccacagctccggtctcaactgcggccgttgggat
tacatcttctccttcatcaagaagttccgcaagcaccccaactttgtcctccccgatcgc
tccgatgtcaccatgaccgttccgttcatggattcctacgtcaagctcctcatcaagacc
tgccatcgccgtggtgtccacgctatgggtggtatggctgctcagatccctatcaaggac
aacgccgcggccaacgacaaggctatggagaacgtccgtgccgacaagctgcgtgaggtc
cgtgccggccacgacggtacctgggtcgctcaccccgctctcgcctccattgcctccgac
gtcttcaacaagtacatgcccacccccaatcagctcttcgtccgccgcgaggacgtcagc
atcaccgccaacgacctgctcaacaccaacgtgcccggcaagattaccgaggacggtatc
cgcaagaacctgaacatcggtctctcctacatggagggctggctccgtggtgtcggctgc
atccccatcaactacctgatggaggacgctgctaccgccgaggtgtcccgctcccagctc
tggcagtgggtctaccaccaggtcaccacctccgagggcaagaagatcgacaaggcctac
gccctgcgtctgctgcaggagcaggccgacagcctcgctgccaagggccccaagggcaac
aagttccagctcgcggcccgctacttcgccggccagatcaccggtgaggcctatgcggat
ttcctgaccagcctgctgtacaacgagatctcgacccccggcactgcgtcgaaactgtga

DBGET integrated database retrieval system