KEGG   Aspergillus clavatus: ACLA_098330Help
Entry
ACLA_098330       CDS       T01148                                 

Definition
(RefSeq) peptidyl prolyl cis-trans isomerase (CypC), putative
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
act  Aspergillus clavatus
Pathway
act03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:act00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ACLA_098330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:act03041]
    ACLA_098330
   03110 Chaperones and folding catalysts [BR:act03110]
    ACLA_098330
Enzymes [BR:act01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ACLA_098330
Spliceosome [BR:act03041]
 Complex B
  Other components
   Prp19-related factors
    ACLA_098330
 Complex C
    ACLA_098330
Chaperones and folding catalysts [BR:act03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    ACLA_098330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 4702450
NCBI-ProteinID: XP_001270317
UniProt: A1CMV4
AA seq 161 aa AA seqDB search
MATDVVFDTSMGSFTVELYNEHAPKTCKNFATLAQRGYYNNVIFHRIIPNFMVQTGDPTG
TGRGGSSIYGEKFEDEIHPGLKHTGAGVLSMANSGPNTNGSQFFVTLAPTPWLDGKHTIF
GRVKSGMRVIQRMGLVKTNPEDRPVDEVKIIRAKVVEDGEE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgatgtggtctttgatacgagcatgggctcgttcactgtagagctttacaat
gagcatgcgccaaagacttgtaagaacttcgcgacgctcgcccaacgaggatactacaac
aacgtcattttccatcgcatcatccccaacttcatggtccaaactggagatcctactggt
actggcagaggaggaagctcgatctacggagagaaatttgaggatgagatccacccgggc
ctcaagcacactggagctggtgtgctgagcatggcaaacagtggacctaataccaatgga
agtcagttctttgtcacgcttgcgcctacgccctggttggatggaaagcacacaatcttc
ggtcgggtgaagagcgggatgcgagtgatccagcgcatgggactcgtcaaaacaaatcca
gaggatagacctgttgatgaggtcaagattatacgcgccaaggtcgtggaagacggcgag
gagtga

DBGET integrated database retrieval system