KEGG   Aspergillus clavatus: ACLA_099280Help
Entry
ACLA_099280       CDS       T01148                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
act  Aspergillus clavatus
Pathway
act00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACLA_099280
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACLA_099280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 4702317
NCBI-ProteinID: XP_001270409
UniProt: A1CN46
AA seq 351 aa AA seqDB search
MAFSSHICVIGSLNIDFAVSTSRCPGPGETLTANSLSVAPGGKGANQAVACGRASLAAEG
QQDVAVTMIGAVGSNDTYYSTLIRPMLKDSGVNTEHIEERTDSTTGSATIIVEEAAGGEN
RILVVPGANHTGMRDVQKILTTLQQMPQSPALVVLQGEIPKDTVVGLLEHFNKPDSTTHV
LFNPAPVFPDGVPLSALIDTTVLVMNETEAAQMRASILGESSSDTLSADDLRPEELAAQF
HEVAKVKIVLITLGAKGVFYSTITGKQGMVDGVRVQKVVDTTAAGDTFVGYFAAAFARFV
STSSLLAGFDDDIENAVQRANCAAAICVQGQGAMQSIPRMMDVDSLQSHQS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcattctcatcacatatctgcgtaatcggttcgctcaacatcgacttcgcagtgtcg
acatcgcggtgtccagggcccggagagacattaaccgccaattcactatctgtagcacca
ggagggaaaggtgccaaccaagccgttgcctgcggacgagcctcgctcgctgctgagggc
cagcaagatgtggcagtcaccatgatcggggccgtcggttccaatgacacatactattcg
accttgatccgtccgatgttaaaggattcgggtgtcaatacggagcatattgaggaacga
acagacagcaccaccgggtcggcgaccatcattgtcgaggaggcagctggcggcgagaat
cgcatcctggtagtaccgggggccaatcatacgggaatgcgtgatgttcagaaaatcctc
actacattacagcaaatgccacagagtccagcgcttgttgtcttgcaaggcgagattccc
aaagatactgttgtggggttgctcgaacactttaataaacccgacagcaccacacacgtt
cttttcaatccggctccggtctttccagacggtgtacccctgtcggcactcatcgatacc
actgtcctggtgatgaatgagacggaggcagcccagatgagagcctcgattctgggagaa
tcgtcaagcgatacgttgagcgcagacgacctgagaccagaagagctggcagcacaattc
cacgaagtcgccaaggtcaagatcgttctgatcactctcggggccaagggcgtcttttac
tccactatcaccggtaaacagggcatggtcgacggagttcgagtacagaaagtggtcgat
acgacggcagcaggagacacctttgtcggatactttgctgcggcatttgctcgctttgtc
tccacatcaagtttgctggccgggtttgatgatgacattgagaatgctgtgcaacgggcc
aattgtgcggcggcgatttgtgtacaagggcaaggggcaatgcagagtatcccgaggatg
atggatgtggatagtttacaatcccaccagtcataa

DBGET integrated database retrieval system