KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_07350Help
Entry
C1701_07350       CDS       T05306                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Brite
KEGG Orthology (KO) [BR:acta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1701_07350
Enzymes [BR:acta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     C1701_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AUS81546
UniProt: A0A2I7YPZ5
Position
complement(1782080..1782940)
Genome map
AA seq 286 aa AA seqDB search
MRIDLHTHSTASDGSDSPEELVAAAARAGLDVVALTDHDTTVGWAPATAALPPGLRLVPG
AELSCVSPDGNGRHVTVHLLAYLFDDTSGELADEQLRLRAERRERLLRMAVMMREDGFPV
DPELLLAELPESSSAGRPHLAAALVRAGVVSSVDEAFARYLGAGSPYHLRRADTPVRRAI
EMIRRAGGVTVLAHPFARARGPVVTAGVITDLAECGLAGLEVNHPDHDPETRAELAGIAR
ELGLVTTGSSDYHGVHKSLRIGQETTDPEQFERLISSATGNHVRGG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgacctgcatacccactccaccgcgtccgacggcagcgacagcccagaagag
ctggtcgctgccgcggcacgcgcgggactcgacgtggtggcgctcaccgaccacgacacc
accgtcgggtgggcgccagccaccgccgccctcccgcccggcctgcgactcgtccccggc
gccgagctgtcctgcgtgtcccccgacggcaacggccgccacgtcacggtccacctgctg
gcctacctgttcgacgacacctcgggcgagctcgcggacgagcagctccggttgcgcgcg
gaacgccgcgagcgcctcctgcggatggccgtgatgatgcgggaggacgggttcccagtc
gatcccgagctgctgctcgccgagctcccggagagctcgtccgcagggcggccgcacctg
gccgccgcactggtccgcgcgggtgtcgtgtccagcgtggacgaggccttcgcccgttac
ctcggcgctggcagcccctaccacctccgccgggcggacaccccggtgcgccgggcgatc
gagatgatcaggcgcgcgggcggcgtcaccgtgctcgcccaccccttcgccagggcgagg
ggcccggtcgtcacggccggggtgatcacggacctcgccgagtgcggcctggcggggctg
gaggtcaaccaccccgaccacgatccggagacccgcgccgagctcgccggtatcgcccgc
gaactcggcctcgtcaccaccggctccagcgactaccacggggtccacaagtcgctccgc
atcggccaggagacgaccgacccggagcagttcgaacggttgatctcctcggcgaccggt
aaccacgtccggggtggttga

DBGET integrated database retrieval system