KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_13280Help
Entry
C1701_13280       CDS       T05306                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Pathway
acta03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acta00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C1701_13280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acta03011]
    C1701_13280
Ribosome [BR:acta03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C1701_13280
  Bacteria
    C1701_13280
  Archaea
    C1701_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUS79166
UniProt: A0A2I7YI35
Position
3099303..3099734
Genome map
AA seq 143 aa AA seqDB search
MNARKDAAAPEDAETPSRAVARARYVRATPMKVRRVVDLVRGRNAQEALAVLQFAPQAAS
EPVAKVVASAVANAQNNLDLDPDTLWISTIYVDEGPTLKRIRPRAQGRAYRVRKRTSHIT
VELESRPKAAAGARKSSAKGSAR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgaaaggacgccgcggcgccggaagacgcggagacgccgtcgcgcgccgtg
gcgcgggcccgctacgtccgcgcgacgccgatgaaggtgcgccgcgtggtcgatctcgtg
aggggccgcaacgcccaggaagctctggccgtgctgcagttcgcgccgcaggcggcgagt
gagccggtagcgaaggtggtcgcgagcgcggtcgccaacgcacagaacaacctggatctt
gacccggacacgctgtggatctcgacgatctacgtggatgaggggccgacgctgaagcgg
attcggccgcgcgcccaggggcgggcgtaccgagtccggaagcggaccagccacatcacc
gtcgagctcgagtcgcggccgaaggccgcggcgggtgctcgcaagtccagcgcgaaggga
agtgcccggtag

DBGET integrated database retrieval system