KEGG   Actinoalloteichus sp. AHMU CJ021: C1701_19020Help
Entry
C1701_19020       CDS       T05306                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
acta  Actinoalloteichus sp. AHMU CJ021
Brite
KEGG Orthology (KO) [BR:acta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1701_19020
Enzymes [BR:acta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     C1701_19020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS MetW Methyltransf_2 Methyltransf_32 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AUS80081
UniProt: A0A2I7YKR9
Position
complement(4484210..4484992)
Genome map
AA seq 260 aa AA seqDB search
MQNPQWDPATYLTFAEERGRPFHDLLARVRTTAPRRVVDLGCGPGNLTADLPRRWPTATV
EALDSSPEMVEEARALGLAAELGDVREWHPSPDTDVVVANALLQWVPEHRELLRRWTREL
PAGATIAFQVPGNQGSPAHVSARQVATTTRWRERLGDALVARADVVSTPTEYGDLLAAAG
CAVDAWETTYLQRLTGEDPVLEWLSGTGLRPVRTQLDDAGWREFREDLAPLLREAYPRRA
DGTTWFPFRRIFVVATTPQG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacccccagtgggaccccgccacctacctcaccttcgccgaggagcggggccgc
cccttccacgacctgctcgcccgggtcaggacgaccgcgccccgccgggtcgtcgacctc
ggctgcggccccggcaacctcaccgccgacctacctcgccggtggcccaccgccacggtc
gaggcgctcgactcctcgcccgagatggtcgaggaggcccgcgcgctcggactggcggcg
gagctgggagacgtccgggagtggcacccgagcccggacaccgacgtcgtcgtcgccaac
gccctcctccagtgggtccccgagcaccgggagctgctccgccgttggacgcgggagctc
ccggctggcgcgaccatcgcctttcaggtccccgggaaccagggcagccccgcgcacgtc
agcgcccgccaggtcgccaccacgacccgctggcgggaacggctcggcgacgcgctcgtc
gcccgcgccgacgtcgtctccacccccaccgagtacggcgacctcctggcggcggccggg
tgcgcggtcgacgcgtgggagaccacctacctccagcggctgaccggcgaggacccggtc
ctggaatggctcagcggaacgggtctccgtccggtgcggacccagctcgacgacgccggg
tggcgtgagttccgagaggacctcgccccgctgctccgggaggcctatccgcgtcgggcg
gacggcacgacgtggttccccttccggcggatcttcgtcgtggcgaccaccccgcagggc
tga

DBGET integrated database retrieval system