KEGG   Actinomyces sp. Chiba101: CHIBA101_0394Help
Entry
CHIBA101_0394     CDS       T05279                                 

Definition
(GenBank) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00520  Amino sugar and nucleotide sugar metabolism
actc01100  Metabolic pathways
actc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CHIBA101_0394
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CHIBA101_0394
Enzymes [BR:actc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CHIBA101_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAW92265
UniProt: A0A1Q2TKI4
Position
complement(465688..466977)
Genome map
AA seq 429 aa AA seqDB search
MTSLDPSPATTPAAGAHCAGRTRVGRRPVLIAALLGTAGLAACGEDSSDSGAAPEQSPSD
APSPAETTSEPAQEPTAAPSETTAPDDPLAGWPLEEKVGQLLMVGVDATTPSQASKDAVT
AHHVGNVFLSGRSTAPAPTISRTVSAFTGLAESATRGTAMLVATDQEGGNVQVLSGSGFS
SIPSGTEQAGQSREQLVASATAWGQELASAGVTMNLAPVADLVDIAGPTSNAPIGQWHRE
YGHDAATVSSQARAFAEGMRAAGVTPVFKHFPGLGRVKENTDTASGVTDSATTRTGDPAV
AIFGDAIAGGAEAIMVSSAYYPQIDAGAPAVFSSTIVTDMLRTEMGFTGVIITDDVSAAI
QVQDWGAGERAVKAVSAGCDLVLASADASVAGDMATALVSAAQSDPALAARIDESARRIL
ALKSARQGG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccctcgacccgagccctgccaccacccctgcggccggcgcccactgcgccgga
cggacgcgcgtgggccggcgccccgtgctgatcgcggccctgctgggaacagcgggcctg
gccgcctgcggcgaggactcctcggactccggcgccgcgcccgagcagagcccgtcggac
gcgccctcccccgccgagacgacgtcggagcccgcccaggagccgaccgccgcgccatcg
gagacgacggcccccgatgacccgctcgcgggctggcccctggaggagaaggtcgggcag
ctcctcatggtgggcgtggacgccaccaccccctcgcaggcctccaaggacgccgtgacc
gcccatcacgtgggcaatgtcttcctgtccgggcgctccaccgcccccgcccccacgatc
agccgcaccgtctccgcgttcaccgggctcgccgaatccgccacccgcggcaccgccatg
ctcgtggccactgatcaggagggcgggaatgtccaggtcctgtccggctccggattctcc
tccatcccgtcgggcaccgagcaggcggggcagtcgcgcgagcagctggtcgcctccgcc
acggcctggggccaggagctcgcgagcgccggggtaacgatgaacctggcgccggtcgcc
gacctcgtcgacatcgccggccccacgtccaacgcccccatcggccagtggcaccgcgag
tacggtcacgacgccgccacggtgagctcacaggcgagggccttcgcggaggggatgcgc
gccgccggcgtcactcccgtcttcaagcacttccccgggctgggcagggtcaaggagaac
accgacaccgcctcgggcgtcaccgactccgcgaccacgcgcaccggggaccccgccgtc
gcgatcttcggggacgcgatcgcgggcggcgccgaggccatcatggtctcctccgcctac
tacccgcagatcgacgccggcgcccccgccgtcttctcctccacgatcgtcacggacatg
ctgcgcaccgagatgggcttcaccggcgtcatcatcaccgatgacgtctcggccgccatc
caggtgcaggactggggggcgggcgagcgcgcggtgaaagcagtgagcgcgggctgcgac
ctcgtcctggcctcggccgacgcctcggtggcgggcgacatggcgacggcgctcgtctca
gccgcgcagtccgatccggcgctggcggcgcggatcgatgagtcggcccggcggatcctg
gcgctcaagagcgccaggcagggcggatga

DBGET integrated database retrieval system