KEGG   Actinomyces sp. Chiba101: CHIBA101_1600Help
Entry
CHIBA101_1600     CDS       T05279                                 

Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
actc  Actinomyces sp. Chiba101
Pathway
actc00260  Glycine, serine and threonine metabolism
actc00630  Glyoxylate and dicarboxylate metabolism
actc00670  One carbon pool by folate
actc01100  Metabolic pathways
actc01110  Biosynthesis of secondary metabolites
actc01130  Biosynthesis of antibiotics
actc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:actc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHIBA101_1600
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHIBA101_1600
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CHIBA101_1600
Enzymes [BR:actc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CHIBA101_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T SoxG
Motif
Other DBs
NCBI-ProteinID: BAW93447
UniProt: A0A1Q2TQ66
Position
1895908..1896771
Genome map
AA seq 287 aa AA seqDB search
MTTAVRPRRTRLHGVHEALGATFTIRDGWEIPLRYSPGGGELNALRGSAGILDLSHLGTF
KAQGPVAGASLDAAITGTDSDDPASAGPASSLPVGRALRARLAADAAPATIYRLGDEEFL
VVTDAADRRSAIGPARGARPRRESVVDATESIALIAVAGPRAEEVMRGVVESGAGMPAAL
LPEEKALGGEDCGPDVLCGPGLLRRLRDGAAVRATACGHTVVLARDRVGGADCLKVFCGA
EDAVDLWEMIVEHASSSAPGMGPVGATPVLTACGLAAWDALAPAAQE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcggtgaggccgcggcgcacccgcctgcacggcgttcacgaggcgctcggc
gccaccttcaccatccgcgacggctgggagatcccgctgcgctactcccccggcggtgga
gagctgaacgcgctgcggggctccgcgggcatcctcgacctctcccacctgggcacgttc
aaggcgcagggccctgtagcgggcgcctccctcgatgccgcgatcaccggcaccgactcc
gatgatcccgcttcggccggaccagcctcctccctccccgtcggccgcgccctgcgggcc
cgactggcggccgacgccgcccctgccaccatctatcgcctcggggacgaggagttcctc
gtggtcacggacgccgccgaccgccgcagtgccatcgggccggcccgcggcgcccgcccg
cgacgggagagcgtcgtcgacgcgacggagtcgatcgcgctcatcgccgtggcggggccc
cgagcggaggaggtcatgcgcggcgtcgtcgagtccggtgcggggatgcccgccgccctg
ctccccgaggagaaggccctcggcggggaggactgcgggcccgacgtgctctgcggcccc
ggcctcctgcggcgcttgcgcgacggggcggccgtgcgggccaccgcctgcgggcacacg
gtggtcctggcgcgagatcgcgtgggcggcgcggattgcctgaaggtgttctgcggggcc
gaggacgccgtcgacctgtgggagatgatcgtcgagcatgcctcctcttcggcgccgggc
atgggccccgtgggcgcgacgcccgtgctcacggcctgtggcctggccgcctgggacgcc
ctggccccggcggcccaggagtag

DBGET integrated database retrieval system