KEGG   Actinoalloteichus sp. GBA129-24: UA75_15100Help
Entry
UA75_15100        CDS       T04619                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UA75_15100
Enzymes [BR:acti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     UA75_15100
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     UA75_15100
    1.1.1.-  
     UA75_15100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APU21030
UniProt: A0A1L7F862
Position
3368962..3370026
Genome map
AA seq 354 aa AA seqDB search
MSARSTSAPARYAVVTAPGVLELRTAAGPPEPAADGVVVSITYCGVCATDTHAFTSGGLI
PPSVFGHEWAGTITAVGDEVTGLAVGDRVVAGVGPACGHCAQCRAGHPEHCDTAFAEANG
VTPDAPRHGGFATDLAVSARRVVRVIDGLDEEQAALVEPTAVTYHAVKRARQPFGAIVVV
QGAGPIGLLTAQHARHAGAGVVLVVEPSPGRRATAQALGFTEVHEPGEGFVARLRQITDG
LGADVVYECSGVADLLQSSAELVRRGGLLALLGYPVTSSDVSYGDWQSRELTVLGSLAYN
HEDFVGAMRSIAGGSVRTEELHTGTVGLDDLSRLLEELASGQSRHAKVLVDPRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaggtcgacctcggctcccgcccgctacgccgtcgtcacagcgcccggcgtc
ctggaactccggaccgctgcggggccgccggaaccggcggccgacggagtcgtcgtgtcc
atcacctactgcggcgtgtgcgccaccgacacccatgccttcacctccggcgggctcatc
ccgccctcggtgttcggacatgagtgggcgggcaccatcaccgcggtcggggacgaggtc
accggcctggcggtgggggatcgggtcgtcgcgggcgtcggcccggcgtgtggtcactgc
gcgcagtgccgcgcaggccaccccgagcactgcgacacggccttcgccgaggcgaacggg
gtcactcccgacgcccctcggcacggcggcttcgcgacggatctcgcggtgagcgcccga
cgggtcgtccgggtgatcgacgggctcgacgaggagcaggccgccctcgtggagcccacc
gccgtcacctatcacgcggtcaagcgggctcggcagcccttcggggcgatcgtggtggtg
cagggggcgggcccgatcggcctgctgaccgcgcagcatgcgcgacacgcgggtgccggg
gtggtgctcgtcgtcgagccgtcccccggtcgccgggcgacggcgcaggcgctgggcttc
accgaggtccatgaaccaggggaggggttcgtcgcccggctccgccagatcaccgacggg
ctcggcgcggacgtcgtctacgagtgcagcggagtggccgacctcctccagtcctcggcg
gaacttgtgcggcgcggcgggctgctggcgctgttgggatatccggtgacgtcctccgac
gttagctacggcgactggcagtcccgtgagctgacggtgctggggtcgctggcgtacaac
cacgaggacttcgtgggcgccatgcggtccatcgccggtggttcggtgcggaccgaggaa
ctgcacaccgggaccgtcgggctggacgatctgtcccggctgctggaggaactcgcctcc
gggcagagccgccacgcgaaggtgttggtcgacccgcgacggtga

DBGET integrated database retrieval system