KEGG   Actinoalloteichus sp. GBA129-24: UA75_18035Help
Entry
UA75_18035        CDS       T04619                                 

Definition
(GenBank) O-methyltransferase
  KO
K21192  methyltransferase [EC:2.1.1.-]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti01059  Biosynthesis of enediyne antibiotics
acti01100  Metabolic pathways
acti01110  Biosynthesis of secondary metabolites
acti01130  Biosynthesis of antibiotics
Module
acti_M00829  3,6-Dimethylsalicylyl-CoA biosynthesis, malonyl-CoA => 6-methylsalicylate => 3,6-dimethylsalicylyl-CoA
Brite
KEGG Orthology (KO) [BR:acti00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    UA75_18035
Enzymes [BR:acti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     UA75_18035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_25 Methyltransf_12 MTS Methyltransf_23 Dimerisation CMAS
Motif
Other DBs
NCBI-ProteinID: APU21597
UniProt: A0A1L7F9W0
Position
4166979..4168025
Genome map
AA seq 348 aa AA seqDB search
MADSNAITVTDSDYLRLIIHGVTAFELLRTALEFDLFERLEQADGMTIDDVASAIEVDQQ
PARILLLGLASLRLLEKRGDAYVNSAVTRRKMLRGSPRFLGPLVDIQAEIINAGIGDFAE
SMRRNTNVGLRHLDGPGTTLYERLTAHPRLQEIFYANMGDASSKALTQLRTLYDFSDIRH
LVDLGGGDGTNSLELVRHHPDLTVTVFDQESVTRLAEARVDDQDLRRRIAYHPGDLFADP
FPQGADAILYFHLFEIFSPARNTRLLRKCHAALPAGGVCLVYNFVSDDEGTGSLSAGLVS
PYFLALASGEGMTYSPADVERAVLAAGFSRVERHDNLGFSHTLIVGHK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcagacagcaacgccatcaccgtcacggactccgactatctccggctgatcatccac
ggtgtgaccgcattcgaattactcaggacggcgttggagttcgacctcttcgagcggttg
gaacaggccgacggaatgacgatcgacgacgtcgcctcggcgatcgaggtcgaccagcag
ccggcccgaatactgctgctcggcctcgcctcccttcggttgctggagaaacgcggtgac
gcgtatgtcaacagcgcggtgacgcgccgcaagatgctccgaggcagtccacgattcctc
ggcccactcgtggacatccaggccgagatcatcaatgccggtatcggtgacttcgccgag
tccatgcgtcgcaacaccaatgtggggctacggcacctcgacggacccggcaccacgctc
tatgaacgcctcaccgcgcatcctcgacttcaggagatcttctacgcgaacatgggcgac
gcgtcgagcaaggcactcacacagctgcgcacgctgtacgacttctcggacatccgccac
ctcgtcgacctcggcggcggggacgggaccaacagcctcgaactcgtcaggcaccacccc
gacctgacggtgacggtcttcgaccaggagagcgtcaccagactcgccgaagccagggtc
gacgaccaggacctgcgacgacgaatcgcctaccaccccggtgacctgttcgccgacccc
ttcccgcaaggcgcggatgcgatcctgtacttccacctcttcgagatcttctccccggca
cgcaacacgcggctcctccgcaagtgccatgcggcactgcctgcgggcggcgtatgcctc
gtctacaacttcgtctccgacgacgagggcaccggctccctgagcgccgggctcgtgtca
ccgtatttcctggccctggcatcgggtgagggcatgacctattcgccggccgacgtcgaa
cgcgccgtgctggccgccggtttctccagagtggagcggcacgacaacctcggattcagc
cacaccctgatcgtcggccacaaatag

DBGET integrated database retrieval system