KEGG   Actinoalloteichus sp. GBA129-24: UA75_18810Help
Entry
UA75_18810        CDS       T04619                                 

Definition
(GenBank) ABC-type sugar transport system, ATPase component
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
acti  Actinoalloteichus sp. GBA129-24
Pathway
acti02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:acti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UA75_18810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acti02000]
    UA75_18810
Enzymes [BR:acti01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     UA75_18810
Transporters [BR:acti02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    UA75_18810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_23 DUF2813 AAA_30 MMR_HSR1 AAA_27 AAA_15 MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: APU21752
UniProt: A0A1L7FAB3
Position
complement(4372500..4374089)
Genome map
AA seq 529 aa AA seqDB search
MSSSTSTDPPRQRVAAAVLETEGVTKSFGGVRALRGVDFRLAAGEIHALVGENGAGKSTL
IKVLTGVHPPDEGEVRFAGAPVDFHRPADAQRAGISTIYQEVNLVPLLSVARNIFLGREP
RTRLGLIDVARMNREAAALVESLGLDVDVRSDLGRLGLGVQQMVALARAMSVSARVVIMD
EPTSSLEAKEVATLFGVARTLRDAGVGLVFVSHRLDELWELCDRVTILRDGRQVHTGRMA
DLSRLALISHMLGRDLEEVRRTGATDFGETHRQDREPVLTASGVQVRGSLHDVGLTVRPG
EVVGLGGLLGSGRTETVQAVYGALPREAGTVRVGGAEVRTNSVGHALRAGIALLSEDRKA
EGIIPDLSVRENIALAVLPRLSRLGLVSESRVDALVATFMARLHIKASSPAQPVRELSGG
NQQKVLIARWLCTEPKVFLLDEPTRGIDVGAKSEVQSLIDELAEQGLAVVLISSEMEELV
EGADRIVVLHDGGVVRELVGEQRTTAELLAALAHDPGTAAEKNEEDAGD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagctccaccagcaccgacccgcctcggcagcgcgtggcggccgccgttctggag
accgagggcgtcaccaagtcgttcggcggcgtgcgcgccttgcgcggtgtcgacttccgg
cttgccgccggtgagatccacgccctggtcggcgagaacggcgcgggcaagtccacgctg
atcaaggtgctgacgggcgtccatccgcccgacgaaggggaggtccgattcgcgggcgcc
cccgtcgacttccaccggcccgccgacgcccagcgggccgggatctccaccatctaccaa
gaggtcaacctggtgccgctgctgtcggtggcccgcaacatcttcctcggtcgcgagccg
aggacccggctcggtctcatcgacgtcgcgcggatgaaccgcgaggccgccgccttggtc
gagtccctcggcctcgacgtcgacgtccgctccgacctcggcaggctcggcctcggcgtc
cagcagatggtggcgctggcgcgggccatgtcggtctcggcacgcgtggtgatcatggac
gagccgacgtcgtcgctggaggccaaggaggtcgccaccctgttcggcgtcgcgcgcacc
ctgcgcgacgcgggcgtgggtctggtcttcgtctcgcaccggctcgacgaactctgggag
ctgtgcgaccgggtcaccatcctgcgcgacggcaggcaggtgcacaccggccggatggcg
gacctgagcaggctggcgctcatctcgcacatgctgggccgcgacctggaggaggtgcgc
cgcaccggagccaccgacttcggcgagacccaccgacaggaccgggagccggtgctcacg
gcgtccggtgtccaggtcaggggcagcctgcacgacgtcggcctgaccgtccgccccggc
gaggtggtcggcctcggcggactgctcggctccggtcgcaccgagacggtgcaggccgtc
tacggcgcgctgccgcgcgaggcgggcaccgtccgggtcggcggtgcggaggtgcgcacg
aactcggtcggccatgccctgcgggcgggcatcgccctgttgtcggaggaccgcaaggcc
gaggggatcatcccggacctctcggtccgagagaacatcgcgctcgccgtgctgccccgg
ctctcccggctgggcctggtgtcggagtcgagggtcgacgccctggtggcgaccttcatg
gcccggctgcacatcaaggcgtcgagcccggcccagcccgtgcgggagctgtccggcggc
aatcagcagaaggtgctgatcgcccggtggctgtgcacggagccgaaggtgttcctgctg
gacgagccgaccagaggcatcgacgtcggcgccaagagcgaggtgcagtcgctcatcgac
gaactcgccgaacagggcctggcggtcgtgctgatctccagcgagatggaggagctggtc
gagggcgccgaccggatcgtcgtgctgcacgacggcggagtggtgcgggagctggtcggc
gagcagcgtacgaccgccgaactgctcgcggcgctggcccacgatcctggcacggcggcc
gagaagaacgaggaggacgcgggtgactga

DBGET integrated database retrieval system