KEGG   Actinoalloteichus sp. GBA129-24: UA75_24920Help
Entry
UA75_24920        CDS       T04619                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
acti  Actinoalloteichus sp. GBA129-24
Brite
KEGG Orthology (KO) [BR:acti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UA75_24920
Enzymes [BR:acti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     UA75_24920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 MTS Methyltransf_31 FtsJ MetW Methyltransf_32 TehB Methyltransf_4 DREV Ubie_methyltran PrmA
Motif
Other DBs
NCBI-ProteinID: APU22962
UniProt: A0A1L7FDR4
Position
complement(5843173..5843952)
Genome map
AA seq 259 aa AA seqDB search
MATTKWNPETYLTFADQRGRPFHELVARIGAEDPRRVVDLGCGPGNLTATLSQRWPDADI
EAVDSSQEMVDAAKAAGVHARLCDVTAWQPDEDVDVVLSNAVLQWVPGHRELLRSWLTRL
RPGAWLAFQVPGNFDAPSHHEIRTLAGSPAWRDRLDGLAMRAPGAVLDAVGYATPLAALG
AEVDAWETTYLQRLTGEDPVLDWVSGTALRPIRSVLTQAGWAEFRAELGPRLRSAYPRQA
DGVTWFPFRRIFVVARRLG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccacgacgaagtggaatccggagacctacctgaccttcgccgaccagcggggcagg
ccctttcacgagctggtcgctcgaatcggtgccgaagatccccggcgggtggtcgacctc
ggctgtgggccgggcaacctcaccgccacgctgtcccaacgctggccggacgccgacatc
gaggcggtcgactcctcgcaggagatggtggacgcggcgaaggcggcaggtgtgcatgcg
cgcctgtgcgacgtcacggcctggcagcccgacgaggacgtcgacgtcgtgctcagcaac
gcggtgctccagtgggttcccggccatcgcgagctgctgcggagctggctgacccggctg
cggcccggcgcgtggctggcctttcaggtgcccggcaacttcgatgcgccctcgcatcac
gagatccgcacgttggcggggtcgcccgcctggcgagaccgcctcgacgggctggccatg
cgcgcaccgggtgccgtcctcgacgcggtgggctacgcgactccgctggcggcgctgggt
gccgaggtcgacgcctgggagaccacctacctccagcggctgaccggggaggacccggtc
ctcgactgggtgagcggaacggcgttgcgcccgatcaggagcgtgttgacccaggcgggc
tgggccgagttccgggccgaactcgggccgaggcttcggtcggcgtatccgagacaggcc
gacggcgtgacctggttcccgttccggcggatcttcgtcgtcgcccggcggctcggctga

DBGET integrated database retrieval system