KEGG   Actinoplanes sp. N902-109: L083_1151Help
Entry
L083_1151         CDS       T02655                                 

Gene name
fbiA
Definition
(GenBank) LPPG:FO 2-phospho-L-lactate transferase
  KO
K11212  LPPG:FO 2-phospho-L-lactate transferase [EC:2.7.8.28]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00680  Methane metabolism
actn01100  Metabolic pathways
actn01120  Microbial metabolism in diverse environments
Module
actn_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    L083_1151 (fbiA)
Enzymes [BR:actn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.28  2-phospho-L-lactate transferase
     L083_1151 (fbiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052 Endonuc-FokI_C
Motif
Other DBs
NCBI-ProteinID: AGL14661
UniProt: R4LBR8
Position
complement(1253032..1253988)
Genome map
AA seq 318 aa AA seqDB search
MRIVVLTGGIGGARFLVGVRAYARRIGAEVTAVVNVGDDVRMHGLQICPDLDSVMYTLGG
AADPERGWGRVGETWVVKEELAKYGAEPSWFGLGDKDTATHLVRTTMLTAGYPLSQVTAA
LCERWQPGVTMLPATDDRLETHVVVDVEGERKAIHFQEWWVRYRGNVPTHRFVFVGADVA
KPAPGVLEAIAAADVVLLAPSNPVVSIAPVLAVQELRDAVANGPAPVVGVAPIIGGAPVR
GMADRCLATLGVEVSAEGVGGLYGARSATGLLDGWLVDTTDDKTDIPGVRVRAVPLWMKD
EEATAAMVASALDLAGVS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgtggtcctgaccggggggatcggcggcgcccggttcctggtgggcgtgcgc
gcatacgcgcggcgcatcggtgccgaggtgacggcggtggtgaacgtcggcgacgacgtt
cggatgcatgggctgcagatatgccccgacctcgacagcgtcatgtacacgctgggcggc
gccgcggatcccgagcgcggctggggccgggtcggtgagacctgggtggtcaaggaggag
ctcgcgaagtacggcgccgagccgtcctggttcggcctgggcgacaaggacaccgcaacc
catctcgtacggaccacgatgctgaccgccggctatccgttgtcgcaggtcaccgccgcc
ctctgcgagcgctggcagccgggcgtgacgatgctcccggccaccgacgaccggctcgag
acccatgtcgtcgtggacgtcgagggcgagcgcaaggcgatccacttccaggagtggtgg
gtgcgctatcgcgggaacgtgccgacgcatcggttcgtcttcgtgggtgccgacgtcgcg
aagcctgctccgggcgtgctcgaggcgatcgcggcggccgatgtcgttctgctggcgccg
agcaacccggtggtgtcgatcgcgcccgttctggccgtacaagaactgcgggatgcggtg
gcgaacggcccggcgccggtcgtcggggtggcgccgatcatcggtggcgctccggtgcgc
ggcatggccgaccgctgcctggccacgctgggcgtcgaggtgagcgccgagggcgtgggc
ggcctctacggcgcgcggtccgcgaccggcctgctggacggctggctggtcgacacgacg
gacgacaaaaccgatattcccggcgtacgggtgagagccgtgccgttgtggatgaaggac
gaggaggcgaccgcagccatggtcgcctccgcgctggacctggcgggggtgtcctga

DBGET integrated database retrieval system