KEGG   Actinoplanes sp. N902-109: L083_1503Help
Entry
L083_1503         CDS       T02655                                 

Definition
(GenBank) nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
actn  Actinoplanes sp. N902-109
Brite
KEGG Orthology (KO) [BR:actn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L083_1503
Enzymes [BR:actn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     L083_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AGL15013
UniProt: R4L906
Position
1629464..1630258
Genome map
AA seq 264 aa AA seqDB search
MRVAVCQLNARDDRTENLAVARDLLARAAAAGATLAVLPEYVDYLGPGAGLPKPEPVDGE
FAAFFAQAARDLGIWVHAGSFHEAGPDDEHTFNTSLVFSPSGELTATYRKIHLYDVEIPG
RVSYQESRTVAPGAETVLTEIDGVPTGLTICYDLRFPELYRTLAIQGAKILVVPAAFMMH
TGRDHWEVLLRARAIENQCYVVAAGQIGDHEPGRTCFGRSMVIDPWGTVLAQAPDTVGVV
TAELDLDRLEEIRQTVPSLANRRL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttgccgtctgtcagctgaacgcccgcgacgaccgtaccgaaaatcttgccgtg
gcccgggacctgctggcgcgcgctgccgcggctggggcgaccctcgccgttcttcccgag
tacgtcgattatctcgggcccggcgccggactgcccaagcccgagcccgtcgatggggag
ttcgcggcattcttcgcgcaggccgctcgtgatctcgggatctgggtgcatgccggttcc
ttccacgaggccggcccggacgacgagcacaccttcaacacgagcctggtcttcagccct
tccggcgagctcacggcgacctaccgcaagatccacctgtacgacgtggagatccccggt
cgcgtttcttatcaggaatcacgcactgtggcccccggcgccgaaaccgtactgaccgag
atcgacggggtgcccacggggttgacgatctgctacgacctgcgcttcccggagctgtac
cgcaccttggcgatccagggcgcgaagattctcgtcgtgcccgcggcgttcatgatgcac
accggccgggaccactgggaggtgctgttgcgcgcccgggcgatcgagaaccagtgctac
gtggtggcggcggggcagatcggcgatcacgaacccgggcggacctgcttcggccgcagc
atggtgatcgatccgtgggggacagtgctcgcccaggcgccggacaccgtgggagtggtg
acggcggagctggacctggaccgcctggaggagatccggcagaccgtgccgagcctggcc
aaccggcggctctga

DBGET integrated database retrieval system