KEGG   Actinoplanes sp. N902-109: L083_1510Help
Entry
L083_1510         CDS       T02655                                 

Gene name
ndk
Definition
(GenBank) Nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00230  Purine metabolism
actn00240  Pyrimidine metabolism
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
actn01130  Biosynthesis of antibiotics
Module
actn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
actn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
actn_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    L083_1510 (ndk)
   00240 Pyrimidine metabolism
    L083_1510 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:actn04131]
    L083_1510 (ndk)
Enzymes [BR:actn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     L083_1510 (ndk)
Membrane trafficking [BR:actn04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    L083_1510 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK ACT Globin
Motif
Other DBs
NCBI-ProteinID: AGL15020
UniProt: R4LIF3
Position
1645457..1645879
Genome map
AA seq 140 aa AA seqDB search
MSTSPAAERSLVLVKPDALRRGLLGEILGRFERKGLVIEALELRTMTAELADQHYAEHVD
KAFYPPLKEFMTSGPLAALVLAGDEVISVVREMIGSTDGRKAAAGTIRGDLALSNRENLV
HASDGPDSAKRELALWFPQL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccagccctgccgccgagcgctcgctcgtgctcgtcaagcccgatgcgctgcgg
cgcggcctgctgggcgagattcttggccggttcgagcgcaagggtctcgtcatcgaggcg
ctggagctgcgcaccatgaccgctgagctggccgaccagcactacgccgagcacgtggac
aaggcgttctacccgccgctcaaggagttcatgacgagcgggccgctggcggcgctcgtg
ctcgcgggcgacgaggtgatctccgtggtgcgcgagatgatcggttcgaccgacgggcgc
aaggccgcggccggcacgatccgcggcgacctggccctgtccaaccgggaaaacctggtg
cacgcctccgacggccccgacagcgccaagcgtgaactcgcgctgtggttcccccagctc
tga

DBGET integrated database retrieval system