KEGG   Actinoplanes sp. N902-109: L083_3945Help
Entry
L083_3945         CDS       T02655                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00361  Chlorocyclohexane and chlorobenzene degradation
actn00625  Chloroalkane and chloroalkene degradation
actn01100  Metabolic pathways
actn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_3945
   00361 Chlorocyclohexane and chlorobenzene degradation
    L083_3945
Enzymes [BR:actn01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     L083_3945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: AGL17455
UniProt: R4LQF7
Position
complement(4652313..4652987)
Genome map
AA seq 224 aa AA seqDB search
MLDVYGTLVRDDGEWAAAIAGHVAGLASVPAAQVAREWDTRIWALADGAHGAGFRTLHDL
NVASLAATLEHFGVCGDAERWCRRQDEAVLFDDSAAFLAGLDVPVCLVSDADTVSLHTVL
RGLGVRADHVVTSEDVRAYKPRPEPFERALRVLGVPASAVVHVGDSPVADIAGAGALGID
TVFVDRRGRGLPAGLRATCVVSTLTQAGEAIGANEANRVRRSSP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgatgtgtacggcaccctggtacgcgacgacggcgagtgggctgccgcgatcgcc
gggcacgtggccgggctggcgtcggtgccggctgcgcaggtggcacgggagtgggacacg
cggatctgggcgttggccgatggcgcgcacggtgctgggttccgtacgctgcacgatctg
aatgtggccagtctggccgcgacgctggaacacttcggggtgtgcggggatgccgagcgg
tggtgccggcggcaggacgaggcggtgctgttcgacgacagcgcggcgttcctggccggg
ctggacgtgccggtgtgcctggtgtcggacgccgacacggtctcgttgcacacggtgcta
cgagggctgggcgtgcgcgccgatcatgtggtgaccagtgaggacgtgcgcgcctacaag
ccgcggccggagccgttcgagcgggcgctgcgggtgctgggggttccggcgtccgcggtg
gtgcacgtgggggactcaccggtggccgacatcgccggggcgggcgcgctgggcatcgac
acggtgttcgtggaccgccggggccggggtctgcccgccgggctgcgcgccacctgcgtg
gtgagcacgctcacgcaggccggggaggccatcggcgccaacgaggcgaacagagtgcgc
aggtcgtcgccgtag

DBGET integrated database retrieval system