KEGG   Actinoplanes sp. N902-109: L083_5458Help
Entry
L083_5458         CDS       T02655                                 

Definition
(GenBank) mycothiol S-conjugate amidase Mca acetylase LmbE
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
actn  Actinoplanes sp. N902-109
Brite
KEGG Orthology (KO) [BR:actn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L083_5458
Enzymes [BR:actn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     L083_5458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AGL18968
UniProt: R4LKM9
Position
complement(6259889..6260770)
Genome map
AA seq 293 aa AA seqDB search
MTRPARGDLSGLRLLTVHAHPDDESSKGAATLVKYARAGAGVLICTMTGGERGDVLNPAL
DRPEVRAGLPARRRAEMARAREILGVRQRFLGFVDSGLPRNGEPVPADGFAVQPLEVATR
ALVAAVREFRPHVLVTYDENGGYPHPDHIRTNRVAVAAFHAAGDVHEYPDAGPVWSPSKL
YYTCAFNRDYFVAIDAAMTAAGLDSPARVVLDTWPRDWPAWEVTTRVECAEYFPVRRAAL
LAHETQVDPAGPELSCPLGLEMKAWPTEDYHLVCSAVPTELPEDDLFAGIVAG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacccggcccgcccgcggggacctgtccggcctgcgactgctcaccgtccacgcccat
cccgacgacgagtccagcaagggcgcggccaccctggtcaagtacgcccgcgccggcgcc
ggcgtgctgatctgcaccatgaccggcggcgagcgcggcgacgtgctcaacccggccctg
gaccgccccgaggtgcgcgccgggctgccggcccggcgccgggccgagatggccagggcg
cgcgagattctcggggtgcggcagcgtttcctcggcttcgtcgactcggggctgcccagg
aacggcgagccggtgccggccgacggcttcgcggtccagccgctcgaggtggccacccgg
gcgcttgtcgcggcggtccgcgagttccgtccgcacgtgctggtcacctatgacgagaac
ggcggctacccgcacccggaccacatcaggaccaatcgggtggcggtggccgcgttccac
gccgcaggggatgtgcacgaatatccggacgccggtccggtgtggagtccgagcaagctg
tactacacctgcgcgttcaaccgggactacttcgtggccatcgacgcggcgatgacggcg
gcgggcctggactcgccggcccgggtggtgctcgacacctggccgcgggactggcctgcc
tgggaggtgaccacccgggtcgagtgcgcggagtacttcccggtgcgccgtgccgcgctg
ctggcccacgagacccaggtcgacccggccgggcccgagctgtcctgcccgctcggcctg
gagatgaaggcgtggccgaccgaggactaccacctggtctgctcggcggtgccgaccgag
ttgccggaggacgacctcttcgccgggatcgtggccgggtaa

DBGET integrated database retrieval system