KEGG   Actinoplanes sp. N902-109: L083_6244Help
Entry
L083_6244         CDS       T02655                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00330  Arginine and proline metabolism
actn00360  Phenylalanine metabolism
actn00380  Tryptophan metabolism
actn00627  Aminobenzoate degradation
actn00643  Styrene degradation
actn01100  Metabolic pathways
actn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    L083_6244
   00360 Phenylalanine metabolism
    L083_6244
   00380 Tryptophan metabolism
    L083_6244
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    L083_6244
   00643 Styrene degradation
    L083_6244
Enzymes [BR:actn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     L083_6244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGL19754
UniProt: R4LVP4
Position
7140227..7141663
Genome map
AA seq 478 aa AA seqDB search
MELIAALRAGMVSSAELTDEAIARIGRDDTVINAICVPDPDRARAAARRADQARSRGADR
PLLGVPVTVKESYDIAGLPTTWGMPQHRNHLPDEDAVQVSRLKAAGAVVLGKTNVPLGLQ
DVQTFNEIHGTTVNPWDHGRTPGGSSGGSAAALASGFGALSIGSDLAGSLRTPAHFCGVY
AHKPTLGLVATRGMVPPGEPALPTAFDLAVAGPMARTARDLTLLLDVMAGPDPLTLGRAH
RLTLPPARHERLSDFRVLILDEHPLLATGSAVRAAVHRVAAALTDGGAHVARHSPLLPDL
TEAATLFMQLLVSGSVARFPTASYDQLRARAAALSPDDRSLDAVRQRAMVFTHRDWMQAD
SRREIHRHGWRRLFADFDAVVCPITPTPAFPHDHHPDPLERHIDIDGVEYPYFDQLVWAG
LPTMPGLPATAIPAGRSPTGLPVGVQLIGPMFEDRTPLRLAELLEQHIGGFQPPPRSA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtggagctgattgccgcgttgcgcgcgggcatggtgtcctcggccgagctgaccgacgag
gcgatcgcccggatcggccgcgacgacacggtgatcaacgcaatctgcgtgccggacccc
gaccgggcacgggccgccgcccggcgcgccgaccaggcccgcagccggggagcggaccgg
ccgctgctgggcgtcccggtgacggtcaaggagtcgtacgacatcgccgggctgcccacg
acctggggcatgccgcagcaccggaaccacctgccggacgaggacgccgtccaggtgtcc
cggctcaaggcggcgggcgcggtggtgctcggcaagaccaacgtgccgctggggctgcag
gacgtccagaccttcaacgagatccacggcaccaccgtcaacccgtgggaccacggccgc
acgccgggcggctcctccggcgggtcggccgcggcgctggcgtccgggttcggcgcgctg
tccatcggctccgacctcgccggttcgctgcgcaccccggcccacttctgcggcgtgtac
gcccacaagccgacgctcgggctggtggccacccgcggcatggtcccgccgggcgagcct
gccctgcccaccgcattcgacctggccgtcgccggtccgatggcgcgcaccgcccgcgac
ctcacgctgctgctcgacgtcatggccggaccggacccgctgacgctcggcagagcgcac
cggctgacgctgccgcccgcccgccacgaacggctcagcgatttccgggtcctgatcctc
gacgagcacccgctgctggcaaccggctcggccgtccgcgcggccgtgcaccgggtggcc
gccgccctgacagacggcggtgcccacgtcgcccggcacagcccgctgctgcccgacctg
accgaggccgccacgctcttcatgcaactgctggtctcagggtccgtcgcgcggttcccc
accgcgtcgtacgaccagctgcgcgcccgcgccgccgccctcagcccggacgaccggagc
ctggacgccgtacggcaacgcgccatggtgttcacccaccgcgactggatgcaggcggac
agccgacgcgagatccaccgccacggctggcgccggctgttcgccgacttcgacgccgtg
gtctgcccgatcaccccgaccccggccttcccgcacgaccaccaccccgaccccctggaa
cggcacatcgacatcgacggcgtcgagtacccgtacttcgaccagctggtctgggccggc
ctgcccacgatgcccggcctgcccgccaccgccatccccgcgggccggtcacccacggga
ctcccggtcggcgtgcaactcatcggcccgatgttcgaggaccgcaccccgctgcgcctg
gccgaactgctcgaacagcacatcggcggcttccagcccccgccgcgcagcgcatga

DBGET integrated database retrieval system